PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS916550 to PF12051 (DUF3533)

VIMSS916550 has 954 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.1e-11   28.1   1.7    5.1e-11   28.1   1.7    3.9  3  VIMSS916550  


Domain annotation for each sequence (and alignments):
>> VIMSS916550  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   28.1   1.7   5.1e-11   5.1e-11      19     159 ..      44     178 ..      26     213 .. 0.72
   2 ?   -2.7   2.9      0.12      0.12      91     175 ..     492     575 ..     422     610 .. 0.57
   3 !    9.3   0.4   2.7e-05   2.7e-05     161     353 ..     716     902 ..     693     926 .. 0.70

  Alignments for each domain:
  == domain 1  score: 28.1 bits;  conditional E-value: 5.1e-11
      DUF3533  19 alyrrsdrlknlnvlvVneDeg..gseltpvvgeavaqainettssslgtwtvvnpsefkeseeeveelvhkekywgaivvkenateklyaal.s..a 111
                  a+ ++  ++ +++v+vVneD+g  +++ + +vg+ + + ++++      +w++v       s+e+  +++  +ky++ i++++ +t +++  l +  +
  VIMSS916550  44 AMWDPYGHTGHIKVAVVNEDQGekVRGKNINVGNKMVKTLKKND---SFDWQFV-------SREKADHEIKMGKYYAGIYIPKKFTHEITGTLrKhpQ 131
                  6888889999************8855555555555555555555...4899999.......699*************************999975114 PP

      DUF3533 112 ngassynstelleliyesgRdattvssyilpaltqleaaalakygsql 159
                  + +  +++++ ++ + ++  d t  s +i +a +q++++++ ++ s+ 
  VIMSS916550 132 KADIDFKVNQKINAVAAKLTD-TGSSFVIDKANKQFNKTVATALLSEA 178
                  445556666777777777776.55566666666666666665554444 PP

  == domain 2  score: -2.7 bits;  conditional E-value: 0.12
      DUF3533  91 ywgaivvkenateklyaalsangassynstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqslsntaqaaq 175
                  +  +i+ +  +t++l +als+ ++ + ++ ++l    + ++   t++ yi++ l+    a+ +++++ql +   ++ls+++ + +
  VIMSS916550 492 ANNSINDNLKSTNQLIDALSNGSSGQLEAVNVLRDLPNLNKRLDTLRNYIKKELNRNLLAVSNEITDQLNK-GQNTLSTIQSKLN 575
                  44566666667888888885445555666677777777777788888888888777777777766666653.3333333333333 PP

  == domain 3  score: 9.3 bits;  conditional E-value: 2.7e-05
      DUF3533 161 qqliqslsntaqaaqlsna.llaspiafnsidlrPftdgvalaplqvgliyliiltffqfaflgklhaemg.lsrklkfkqllvyrllisvvslfvlS 256
                   +li +l+n  ++    +a ++a+pi+ ++ d+ P++d  + +++ ++ ++ i + +  ++ l ++ ++ + l++ +  +q+ + +     ++ ++ +
  VIMSS916550 716 DKLIDTLKNDLKK----QAdIVANPINKKTTDVFPVKDY-GSGMTPFYTALSIWVGGLLMVSLLSVDNKHEhLQPIMTKRQVYLGKSGFFFLLGIIQA 808
                  3444444443333....3349***************996.456667********************99999778888888886666555555555555 PP

      DUF3533 257 lffslvs.lafqvdftvafGragFvvyWmitwlvmaavglanenvasilgppylpvwllfwvi.lNvsstfvPlelspgFYrygyal.Plhniveilr 351
                  l++s+   ++++  +       +++++  i ++  +++  ++ + +s+lg+p+ +v+++++v  ++   +++P++  p+F++      P+ +++++lr
  VIMSS916550 809 LIVSIGDlVILKASI------ESPILFVSIAVFSSLVFNSIIYTSVSLLGNPGKAVAIILLVLqIAGGGGTFPIQTTPEFFQAISPYlPFTYSIDALR 900
                  555544434555555......4555555566666666666777778899******99998875345555************98877669988888888 PP

      DUF3533 352 vI 353
                    
  VIMSS916550 901 ET 902
                  65 PP



Or compare VIMSS916550 to CDD or PaperBLAST