PaperBLAST – Find papers about a protein or its homologs

 

Align WP_000786119.1 to PF12051 (DUF3533)

WP_000786119.1 has 993 amino acids

Query:       DUF3533  [M=378]
Accession:   PF12051.8
Description: Protein of unknown function (DUF3533)
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    7.1e-11   27.6   0.5    7.1e-11   27.6   0.5    3.2  4  WP_000786119.1  


Domain annotation for each sequence (and alignments):
>> WP_000786119.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   27.6   0.5   7.1e-11   7.1e-11      19     160 ..      42     177 ..      25     212 .. 0.67
   2 ?   -7.0   4.0         1         1     118     167 ..     399     448 ..     379     472 .. 0.44
   3 ?   -2.9   0.6      0.14      0.14     145     179 ..     593     625 ..     556     693 .. 0.64
   4 !   11.2   0.6   6.9e-06   6.9e-06     162     351 ..     756     939 ..     725     961 .. 0.76

  Alignments for each domain:
  == domain 1  score: 27.6 bits;  conditional E-value: 7.1e-11
         DUF3533  19 alyrrsdrlknlnvlvVneDeg..gseltpvvgeavaqainettssslgtwtvvnpsefkeseeeveelvhkekywgaivvkenateklyaal.s 110
                     a+ ++  ++ +++v+vVneD+g   ++ + +vg+++ + +++++     +w++v       s+e+  +++  +ky++ i++++ +t +++  l +
  WP_000786119.1  42 AMWDPYGNTGHIKVAVVNEDKGdtIRGKKVNVGNTMVNTLKKNK---SFDWQFV-------SREKADHEIKMGKYFAGIYIPSKFTHEITGTLrK 126
                     56777788899***********9988888888888888888777...4899999.......699**************************99943 PP

         DUF3533 111 a..ngassynstelleliyesgRdattvssyilpaltqleaaalakygsqll 160
                     +  + ++++++++ ++ +  +  d t  s ++ +a +q+++++++++ ++  
  WP_000786119.1 127 QpqKADVEFKVNQKINAVASKLTD-TGSSVVVEKANEQFNKTVTRALLEEAN 177
                     300223334444444444444443.333333333333333333333333322 PP

  == domain 2  score: -7.0 bits;  conditional E-value: 1
         DUF3533 118 nstelleliyesgRdattvssyilpaltqleaaalakygsqllqqliqsl 167
                     ++t + ++  + g+++  +++  ++++++ ++  + k ++++   l++sl
  WP_000786119.1 399 STTPQSTSGKKDGQSFADITTTQVSTANENTQNITDKDVKSMEAALTGSL 448
                     44444444444444444444333333333333333333333333333333 PP

  == domain 3  score: -2.9 bits;  conditional E-value: 0.14
         DUF3533 145 tqleaaalakygsqllqqliqslsntaqaaqlsna 179
                     + + +++++  g++ l+++ ++l++++q+ ++ ++
  WP_000786119.1 593 QRIMDELNK--GQTALSNVQSKLNTIDQVINSGQS 625
                     444444443..444444444444444444443222 PP

  == domain 4  score: 11.2 bits;  conditional E-value: 6.9e-06
         DUF3533 162 qliqslsntaqaaqlsna.llaspiafnsidlrPftdgvalaplqvgliyliiltffqfaflgklhaemg.lsrklkfkqllvyrllisvvslfv 254
                     +li     t ++++ ++a ++a+pi+ +++d+ P++d  + +++ ++ ++ + +    ++ l  + ++   l + l  +q+++ +    +++ + 
  WP_000786119.1 756 KLID----TLKNDLKKQAgIIANPINKKTVDVFPVKDY-GSGMTPFYTALSVWVGALLMVSLLTVDNKHKsLEPVLTTRQVFLGKAGFFIMLGML 845
                     3333....33334434446****************996.455667******99999999999999999888899999999999999999999999 PP

         DUF3533 255 lSlffslvs.lafqvdftvafGragFvvyWmitwlvmaavglanenvasilgppylpvwllfwvilNvss..tfvPlelspgFYrygyal.Plhn 345
                      +l++s+   l+++  +       ++v++ +it ++ + +  +  + +s+lg+p+ +++++++v   ++   +++P++  p+F++      P+ +
  WP_000786119.1 846 QALIVSVGDlLILKAGV------ESPVLFVLITIFCSIIFNSIVYTCVSLLGNPGKAIAIVLLVL-QIAGggGTFPIQTTPQFFQNISPYlPFTY 933
                     99998888767888888......789988888888877777777778888899999988776654.444445************97665557776 PP

         DUF3533 346 iveilr 351
                     +++ lr
  WP_000786119.1 934 AIDSLR 939
                     666665 PP



Or compare WP_000786119.1 to CDD or PaperBLAST