PaperBLAST – Find papers about a protein or its homologs

 

Align L8Y7J9 to PF12130 (bMERB_dom)

L8Y7J9 has 761 amino acids

Query:       bMERB_dom  [M=134]
Accession:   PF12130.12
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.8e-34  104.9  13.5    1.2e-29   89.3   8.4    2.2  2  L8Y7J9    


Domain annotation for each sequence (and alignments):
>> L8Y7J9  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   89.3   8.4   1.2e-29   1.2e-29       1      87 [.     607     692 ..     607     695 .. 0.98
   2 !   18.6   0.2   8.4e-08   8.4e-08     107     133 ..     702     728 ..     699     729 .. 0.93

  Alignments for each domain:
  == domain 1  score: 89.3 bits;  conditional E-value: 1.2e-29
  bMERB_dom   1 iqreleeieeelkeleergvelEkkLReseegeeeeeelleewfeLvneknalvrreseLvilakeqeLeeeqaeleqelrelleke 87 
                iqr++++ie++l++le rg elEk+LR  +eg+ +e+ l+ +wf+L++ek+ l+r eseL++ +k+q+Lee+q++le elr+l++k+
     L8Y7J9 607 IQRQVQKIEQQLDALELRGIELEKRLR-AAEGDASEDGLMVDWFQLIHEKQLLLRLESELMYKSKDQRLEEQQQDLEGELRRLMAKP 692
                8**************************.5899****************************************************997 PP

  == domain 2  score: 18.6 bits;  conditional E-value: 8.4e-08
  bMERB_dom 107 veiVekRdelvesleedrlreeeedee 133
                v++V++R++++++l edrlre+eed++
     L8Y7J9 702 VSTVNDRSDIIDFLAEDRLREKEEDQM 728
                899**********************97 PP



Or compare L8Y7J9 to CDD or PaperBLAST