PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001092402.1 to PF12130 (DUF3585)

NP_001092402.1 has 883 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      1e-44  138.2  17.2    1.6e-44  137.6  17.2    1.3  1  NP_001092402.1  


Domain annotation for each sequence (and alignments):
>> NP_001092402.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  137.6  17.2   1.6e-44   1.6e-44       1     134 [.     713     843 ..     713     845 .. 0.97

  Alignments for each domain:
  == domain 1  score: 137.6 bits;  conditional E-value: 1.6e-44
         DUF3585   1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKte 95 
                     iqr++++ie+++++le +gv lEk+LR   + +g+++e++l+ +wf+Lv+ek+ l+r eseLm+ ar+q+Le++q dle elr+lmak+e  K++
  NP_001092402.1 713 IQRQVQDIERQLDALELQGVGLEKRLR---AAEGDDSEDALMVDWFRLVHEKQLLLRLESELMYKARDQRLEEQQLDLEGELRRLMAKPEGLKSP 804
                     8**************************...4467999********************************************************** PP

         DUF3585  96 edkereeelleelvevVeqRdelvdsleedrlreaeede 134
                     +d++re+ ll+++v  V+ R+ ++d l+edrlre+eede
  NP_001092402.1 805 QDRRREQDLLDQYVHTVNSRSDIIDFLDEDRLREQEEDE 843
                     **************************************8 PP



Or compare NP_001092402.1 to CDD or PaperBLAST