PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001099867.1 to PF12130 (DUF3585)

NP_001099867.1 has 1047 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.9e-32   97.9  23.7    2.9e-32   97.9  23.7    2.5  3  NP_001099867.1  


Domain annotation for each sequence (and alignments):
>> NP_001099867.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -5.5   3.6         1         1      92      98 ..     856     862 ..     846     869 .. 0.41
   2 ?   -2.4   0.1      0.27      0.27      70     104 ..     875     909 ..     871     911 .. 0.80
   3 !   97.9  23.7   2.9e-32   2.9e-32       1     130 [.     918    1045 ..     918    1046 .. 0.96

  Alignments for each domain:
  == domain 1  score: -5.5 bits;  conditional E-value: 1
         DUF3585  92 eKteedk 98 
                     e +ee++
  NP_001099867.1 856 EEEEEEE 862
                     1111111 PP

  == domain 2  score: -2.4 bits;  conditional E-value: 0.27
         DUF3585  70 eLedeqadleqelrelmakeekeKteedkereeel 104
                     e+e+    l ++  ++++ + +++t   +++eee+
  NP_001099867.1 875 EVEQSLLTLAKNSGDMTKYPTWRRTLMRRAKEEEM 909
                     56666667788889999999999999999999986 PP

  == domain 3  score: 97.9 bits;  conditional E-value: 2.9e-32
         DUF3585    1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeK 93  
                      iqr+l+eie  +rele +g +lE aLR+e++ s e++++ +l+++++L+++kn+lv +e+eLmi+ +e++Le++q +l++e r + + ee+ K
  NP_001099867.1  918 IQRRLNEIEAAMRELETEGMKLEVALRKESS-SPEKQKKLWLEQLLQLIQKKNSLVTEEAELMITVQELDLEEKQRQLDHEFRGI-NREETLK 1008
                      8**************************8885.88999999*******************************************85.7899*** PP

         DUF3585   94 teedkereeelleelvevVeqRdelvdsleedrlrea 130 
                      t++d+  e+++l++l++vV+qRd+l++  ee rlre+
  NP_001099867.1 1009 TQADRLSEDRVLRKLLDVVNQRDALIQFQEERRLREM 1045
                      **********************************995 PP



Or compare NP_001099867.1 to CDD or PaperBLAST