PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001178014.1 to PF12130 (DUF3585)

NP_001178014.1 has 1997 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.8e-52  161.9  29.6    4.8e-52  161.9  29.6    2.8  3  NP_001178014.1  


Domain annotation for each sequence (and alignments):
>> NP_001178014.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -9.8   6.9         1         1      86     134 ..     997    1047 ..     974    1049 .. 0.54
   2 ?   -5.9   2.7         1         1      71     102 ..    1114    1144 ..    1109    1145 .. 0.74
   3 !  161.9  29.6   4.8e-52   4.8e-52       1     136 []    1849    1983 ..    1849    1983 .. 0.98

  Alignments for each domain:
  == domain 1  score: -9.8 bits;  conditional E-value: 1
         DUF3585   86 makeekeKteedkereeelleelvevVeqRdelv..dsleedrlreaeede 134 
                       + +e+e +ee++e  e   ++l +++   d l    +++ + +re+ee+e
  NP_001178014.1  997 YEDDEEEYDEEEEESSEAGNKRLQQIITAADPLAiqADVHWTHIREREEEE 1047
                      444555555555666666666666666666644311334444555655555 PP

  == domain 2  score: -5.9 bits;  conditional E-value: 1
         DUF3585   71 LedeqadleqelrelmakeekeKteedkeree 102 
                      L + q++++ +l+ +++ +e+eK ++  ++ee
  NP_001178014.1 1114 L-QSQTKVKADLELRVSENEEEKPSDTPKQEE 1144
                      4.568889999999999999998877777666 PP

  == domain 3  score: 161.9 bits;  conditional E-value: 4.8e-52
         DUF3585    1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeK 93  
                      iqr+le++ee+qr+leergv++EkaLRgea+  g++++++l+qewf+Lv+ekn++vr+eseLmi+are+eLed+q++l+qelre+ma+e++ K
  NP_001178014.1 1849 IQRQLEQVEEKQRQLEERGVAVEKALRGEAG-MGKKDDPKLMQEWFKLVQEKNAMVRYESELMIFARELELEDRQSRLQQELRERMAVEDHLK 1940
                      8**************************9997.789********************************************************** PP

         DUF3585   94 teedkereeelleelvevVeqRdelvdsleedrlreaeedeel 136 
                      tee+  +e+++l+e++evVeqRd+lv  lee+rlre+eed++l
  NP_001178014.1 1941 TEEELSEEKKILNEMLEVVEQRDSLVALLEEQRLREKEEDKDL 1983
                      ****************************************985 PP



Or compare NP_001178014.1 to CDD or PaperBLAST