PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001273542.1 to PF12130 (DUF3585)

NP_001273542.1 has 1086 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.3e-37  114.4  21.5    5.6e-37  113.1  21.5    1.7  1  NP_001273542.1  


Domain annotation for each sequence (and alignments):
>> NP_001273542.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  113.1  21.5   5.6e-37   5.6e-37       1     130 [.     950    1078 ..     950    1080 .. 0.97

  Alignments for each domain:
  == domain 1  score: 113.1 bits;  conditional E-value: 5.6e-37
         DUF3585    1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeK 93  
                      iqr+l+eie  +rele++gv+lE aLR++++ s e++++ ++ ++++Lv +kn+lv +e+eLmi+ +e++Le++q++l+qelr +m+ ee+ K
  NP_001273542.1  950 IQRRLNEIEAALRELEAEGVKLELALRRQSS-SPEQQKKLWVGQLLQLVDKKNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREENLK 1041
                      8**************************8775.78999999***************************************************** PP

         DUF3585   94 teedkereeelleelvevVeqRdelvdsleedrlrea 130 
                      t +d+++e+++l++lv++V+qRd+l++  ee rl e 
  NP_001273542.1 1042 TAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSEL 1078
                      *********************************9885 PP



Or compare NP_001273542.1 to CDD or PaperBLAST