PaperBLAST – Find papers about a protein or its homologs

 

Align NP_001299826.1 to PF12130 (DUF3585)

NP_001299826.1 has 783 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-46  144.5  22.5    1.2e-46  144.5  22.5    2.0  2  NP_001299826.1  


Domain annotation for each sequence (and alignments):
>> NP_001299826.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.0   0.5       0.1       0.1      89     111 ..     415     437 ..     400     442 .. 0.58
   2 !  144.5  22.5   1.2e-46   1.2e-46       1     136 []     613     749 ..     613     749 .. 0.93

  Alignments for each domain:
  == domain 1  score: -1.0 bits;  conditional E-value: 0.1
         DUF3585  89 eekeKteedkereeelleelvev 111
                     e+++ +e++ke+ + ++ ++v+v
  NP_001299826.1 415 EKEKENEKEKEKAKAVIGKMVKV 437
                     22333344555555666666665 PP

  == domain 2  score: 144.5 bits;  conditional E-value: 1.2e-46
         DUF3585   1 iqreleeieeeqreleergvelEkaLRgeae.esgeeeeee....llqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakee 90 
                     iq+el+eie +++ele++gvelEk+LR+  e  +++    +    l+ +wf+L+++k+  +rreseL+++ar+q+Le+eq  ++ elr+lm+k++
  NP_001299826.1 613 IQKELKEIEMNMNELEKKGVELEKQLRQCDEdGEED----AlmndLMVDWFTLIRNKQVYMRRESELVYIARTQDLEEEQPSVDAELRRLMEKPD 703
                     89*************************444333334....345559************************************************* PP

         DUF3585  91 keKteedkereeelleelvevVeqRdelvdsleedrlreaeedeel 136
                     + Kt +d++reeel+++lve+V++R+++v+ l+edrlre+eede+l
  NP_001299826.1 704 HLKTLWDRKREEELMAKLVEIVNDRNAIVEGLDEDRLREEEEDEQL 749
                     *******************************************985 PP



Or compare NP_001299826.1 to CDD or PaperBLAST