PaperBLAST – Find papers about a protein or its homologs

 

Align NP_056056.2 to PF12130 (DUF3585)

NP_056056.2 has 2002 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      1e-51  160.8  29.6      1e-51  160.8  29.6    2.3  2  NP_056056.2  


Domain annotation for each sequence (and alignments):
>> NP_056056.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -9.5   6.9         1         1       3      21 ..    1022    1040 ..     994    1054 .. 0.43
   2 !  160.8  29.6     1e-51     1e-51       1     136 []    1854    1988 ..    1854    1988 .. 0.98

  Alignments for each domain:
  == domain 1  score: -9.5 bits;  conditional E-value: 1
      DUF3585    3 releeieeeqreleergve 21  
                   ++l+++ +  + le ++ +
  NP_056056.2 1022 QRLQQVMHAADPLEIQADV 1040
                   2333333333333333333 PP

  == domain 2  score: 160.8 bits;  conditional E-value: 1e-51
      DUF3585    1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKtee 96  
                   iqr+l+++ee+qr leergv++EkaLRgea+  g++++++l+qewf+Lv+ekn++vr+eseLmi+are+eLed+q++l+qelre+ma+e++ Ktee
  NP_056056.2 1854 IQRQLQQVEERQRRLEERGVAVEKALRGEAG-MGKKDDPKLMQEWFKLVQEKNAMVRYESELMIFARELELEDRQSRLQQELRERMAVEDHLKTEE 1948
                   8**************************9997.789************************************************************* PP

      DUF3585   97 dkereeelleelvevVeqRdelvdsleedrlreaeedeel 136 
                   +  +e+++l+e++evVeqRd+lv  lee+rlre+eed++l
  NP_056056.2 1949 ELSEEKQILNEMLEVVEQRDSLVALLEEQRLREREEDKDL 1988
                   *************************************985 PP



Or compare NP_056056.2 to CDD or PaperBLAST