PaperBLAST – Find papers about a protein or its homologs

 

Align NP_081863.2 to PF12130 (DUF3585)

NP_081863.2 has 680 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    2.2e-45  140.4  30.6    2.2e-45  140.4  30.6    2.1  3  NP_081863.2  


Domain annotation for each sequence (and alignments):
>> NP_081863.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.8   0.1      0.75      0.75     103     121 ..     176     194 ..     171     208 .. 0.62
   2 ?   -2.7   0.9      0.32      0.32      64      77 ..     506     519 ..     496     529 .. 0.47
   3 !  140.4  30.6   2.2e-45   2.2e-45       1     135 [.     532     665 ..     532     666 .. 0.98

  Alignments for each domain:
  == domain 1  score: -3.8 bits;  conditional E-value: 0.75
      DUF3585 103 elleelvevVeqRdelvds 121
                  + l++lv   eq+++l d 
  NP_081863.2 176 LGLKKLVLTEEQKNKLLDW 194
                  4566777777777777664 PP

  == domain 2  score: -2.7 bits;  conditional E-value: 0.32
      DUF3585  64 ilareqeLedeqad 77 
                  il+r ++Le++ a+
  NP_081863.2 506 ILRRRRKLEKQSAK 519
                  23333333332222 PP

  == domain 3  score: 140.4 bits;  conditional E-value: 2.2e-45
      DUF3585   1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKteedk 98 
                  iqr+lee+ee+qr+l  +gv+lEk LRgea+ sg+++e++llqewf+Lv ekn+l+r+eseL i+a+e+eLed+q++leq+lr+ m k+e +K+e+d 
  NP_081863.2 532 IQRQLEEVEERQRTLAIQGVKLEKVLRGEAD-SGTQDEAQLLQEWFKLVLEKNKLMRYESELLIMAQELELEDHQSRLEQKLRQKMLKDEGQKDENDL 628
                  8**************************9995.99**************************************************************** PP

      DUF3585  99 ereeelleelvevVeqRdelvdsleedrlreaeedee 135
                  ++e+e++ee+++v+eqR++lvdslee+r++e+ +d++
  NP_081863.2 629 KEEQEIFEEMMQVIEQRNKLVDSLEEQRVKERTQDQH 665
                  ***********************************97 PP



Or compare NP_081863.2 to CDD or PaperBLAST