PaperBLAST – Find papers about a protein or its homologs

 

Align NP_116256.2 to PF12130 (DUF3585)

NP_116256.2 has 695 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.7e-46  142.0  31.8    6.7e-46  142.0  31.8    2.4  2  NP_116256.2  


Domain annotation for each sequence (and alignments):
>> NP_116256.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.7   2.7      0.16      0.16      62      92 ..     509     539 ..     504     545 .. 0.69
   2 !  142.0  31.8   6.7e-46   6.7e-46       1     135 [.     547     680 ..     547     681 .. 0.98

  Alignments for each domain:
  == domain 1  score: -1.7 bits;  conditional E-value: 0.16
      DUF3585  62 LmilareqeLedeqadleqelrelmakeeke 92 
                  L +  +e++  ++ ++le+ +++l+++ee +
  NP_116256.2 509 LSLQLKEKKTLRRRKKLEKAMKQLVKQEELK 539
                  6666677777777777777777777777654 PP

  == domain 2  score: 142.0 bits;  conditional E-value: 6.7e-46
      DUF3585   1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKteedk 98 
                  iqr+lee+ee+qr+ e +gv+lEkaLRgea+ sg+++e++llqewf+Lv ekn+l+r+eseL i+a+e+eLed+q++leq+lre m kee++K+e+d 
  NP_116256.2 547 IQRQLEEVEERQRASEIQGVRLEKALRGEAD-SGTQDEAQLLQEWFKLVLEKNKLMRYESELLIMAQELELEDHQSRLEQKLREKMLKEESQKDEKDL 643
                  8**************************9995.99**************************************************************** PP

      DUF3585  99 ereeelleelvevVeqRdelvdsleedrlreaeedee 135
                  ++e+e+++el++v+eqRd+lvdslee+r+re++ed++
  NP_116256.2 644 NEEQEVFTELMQVIEQRDKLVDSLEEQRIREKAEDQH 680
                  ***********************************97 PP



Or compare NP_116256.2 to CDD or PaperBLAST