PaperBLAST – Find papers about a protein or its homologs

 

Align NP_203744.1 to PF12130 (DUF3585)

NP_203744.1 has 863 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
      3e-49  152.9  16.8    4.8e-49  152.2  16.8    1.3  1  NP_203744.1  


Domain annotation for each sequence (and alignments):
>> NP_203744.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  152.2  16.8   4.8e-49   4.8e-49       1     135 [.     684     815 ..     684     816 .. 0.97

  Alignments for each domain:
  == domain 1  score: 152.2 bits;  conditional E-value: 4.8e-49
      DUF3585   1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKteedk 98 
                  i+ e++ ie+++++le+rgv lE++LR   +  +e +e+++l +wf+L++ek+ lvrreseL+++ ++q+Le++qad+e+elr+l++k+ek++teed+
  NP_203744.1 684 IHGEMDTIERRLDALEHRGVLLEEKLR---GGLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDR 778
                  6789***********************...6567999************************************************************* PP

      DUF3585  99 ereeelleelvevVeqRdelvdsleedrlreaeedee 135
                  +re+ l++elv+++eqR++++++l+edr+re+eed++
  NP_203744.1 779 AREKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKM 815
                  ***********************************97 PP



Or compare NP_203744.1 to CDD or PaperBLAST