NP_203744.1 has 863 amino acids
Query: bMERB_dom [M=134] Accession: PF12130.12 Description: Bivalent Mical/EHBP Rab binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-48 151.0 16.6 1.7e-48 150.3 16.6 1.3 1 NP_203744.1 Domain annotation for each sequence (and alignments): >> NP_203744.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 150.3 16.6 1.7e-48 1.7e-48 1 133 [. 684 815 .. 684 816 .. 0.97 Alignments for each domain: == domain 1 score: 150.3 bits; conditional E-value: 1.7e-48 bMERB_dom 1 iqreleeieeelkeleergvelEkkLReseegeeeeeelleewfeLvneknalvrreseLvilakeqeLeeeqaeleqelrellekedsekteedkkr 98 i+ e++ ie++l++le+rgv lE+kLR+ +e +e+++l +wf+L++ek+ lvrreseL ++ k+q+Le++qa++e+elr+ll+k+++++teed++r NP_203744.1 684 IHGEMDTIERRLDALEHRGVLLEEKLRG-GLNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRAR 780 6789***********************5.7889***************************************************************** PP bMERB_dom 99 eeelleelveiVekRdelvesleedrlreeeedee 133 e+ l++elv+++e+R++++++l+edr+reeeed++ NP_203744.1 781 EKVLMQELVTLIEQRNAIINCLDEDRQREEEEDKM 815 *********************************97 PP
Or compare NP_203744.1 to CDD or PaperBLAST