PaperBLAST – Find papers about a protein or its homologs

 

Align NP_505468.1 to PF12130 (DUF3585)

NP_505468.1 has 901 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.3e-19   57.0   7.3    1.3e-19   57.0   7.3    2.2  2  NP_505468.1  


Domain annotation for each sequence (and alignments):
>> NP_505468.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.7   0.8      0.16      0.16      67     104 ..     551     588 ..     548     594 .. 0.76
   2 !   57.0   7.3   1.3e-19   1.3e-19       3     134 ..     741     867 ..     739     869 .. 0.95

  Alignments for each domain:
  == domain 1  score: -1.7 bits;  conditional E-value: 0.16
      DUF3585  67 reqeLedeqadleqelrelmakeekeKteedkereeel 104
                  +  eL ++  dl ++     a ++++K +++++r ee+
  NP_505468.1 551 KRDELRQRARDLIEKSTTPAATPNSRKASDEERRREEV 588
                  66789999999999999999999988877776666654 PP

  == domain 2  score: 57.0 bits;  conditional E-value: 1.3e-19
      DUF3585   3 releeieeeqreleergvelEkaLRgeae.esgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKteedke 99 
                  +el +i+e+ +++ +++ +++ ++R   e e g++eee l+ +++eL+ne+n+lv+r++ ++i++  +++  e+++l ++++e+   ++  +++e+k+
  NP_505468.1 741 NELVRIDERISDITAQADVIQDKIR---EtEVGSSEEEMLTASYLELTNERNTLVHRQEYYNIIETIRQVTSEIDQLGKQINEVP--DDFPRSDENKT 833
                  7999*********************...446899************************************************985..789******** PP

      DUF3585 100 reeelleelvevVeqRdelvdsleedrlreaeede 134
                  + ++l+e++ + ++ +++lv++l +++  e eed 
  NP_505468.1 834 ATDKLIEQYSDAMKTKSNLVQKLFATED-EIEEDS 867
                  *************************999.999997 PP



Or compare NP_505468.1 to CDD or PaperBLAST