Q8VDP3 has 1048 amino acids
Query: bMERB_dom [M=134] Accession: PF12130.12 Description: Bivalent Mical/EHBP Rab binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-37 112.4 24.9 8.6e-37 112.4 24.9 2.3 4 Q8VDP3 Domain annotation for each sequence (and alignments): >> Q8VDP3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.7 0.1 0.63 0.63 79 96 .. 481 499 .. 477 514 .. 0.53 2 ? -4.9 2.1 1 1 123 130 .. 856 863 .. 848 868 .. 0.42 3 ? -3.4 0.2 0.51 0.51 68 102 .. 875 909 .. 863 910 .. 0.79 4 ! 112.4 24.9 8.6e-37 8.6e-37 1 128 [. 918 1046 .. 918 1047 .. 0.97 Alignments for each domain: == domain 1 score: -3.7 bits; conditional E-value: 0.63 bMERB_dom 79 elrelleked.sekteedk 96 +l ++++ke ++k++e Q8VDP3 481 DLYDMMDKEHaQRKSDEPD 499 5556666665233333333 PP == domain 2 score: -4.9 bits; conditional E-value: 1 bMERB_dom 123 drlreeee 130 +++ eeee Q8VDP3 856 EEEEEEEE 863 22212222 PP == domain 3 score: -3.4 bits; conditional E-value: 0.51 bMERB_dom 68 eLeeeqaeleqelrellekedsekteedkkreeel 102 eLe+ +l ++ +++ + +++t +++eee+ Q8VDP3 875 ELEQTLLTLAKNPGAMTKYPTWRRTLMRRAKEEEM 909 67777777777778888888888888888888875 PP == domain 4 score: 112.4 bits; conditional E-value: 8.6e-37 bMERB_dom 1 iqreleeieeelkeleergvelEkkLR.eseegeeeeeelleewfeLvneknalvrreseLvilakeqeLeeeqaeleqelrellekedsekteedkk 97 iqr+l+eie++++ele++g +lE +LR es++ e++++ +l +++ L+++kn+lv +e+eL+i+ +e++Lee+q++l++elr +++ e++ kte+d + Q8VDP3 918 IQRRLNEIEATMRELEAEGTKLELALRkESSSPEQQKKLWLDQLLRLIQKKNSLVTEEAELMITVQELDLEEKQRQLDHELRGYMNREETMKTEADLQ 1015 8**************************8777888888889********************************************************** PP bMERB_dom 98 reeelleelveiVekRdelvesleedrlree 128 e+++l++l+e+V++Rd+l+++ ee+rlre+ Q8VDP3 1016 SENQVLRKLLEVVNQRDALIQFQEERRLREM 1046 *****************************96 PP
Or compare Q8VDP3 to CDD or PaperBLAST