SwissProt::D3ZEN0 has 1014 amino acids
Query: bMERB_dom [M=134] Accession: PF12130.12 Description: Bivalent Mical/EHBP Rab binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-46 143.6 20.5 2.8e-46 143.1 20.5 1.2 1 SwissProt::D3ZEN0 Domain annotation for each sequence (and alignments): >> SwissProt::D3ZEN0 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 143.1 20.5 2.8e-46 2.8e-46 2 133 .. 852 982 .. 851 983 .. 0.98 Alignments for each domain: == domain 1 score: 143.1 bits; conditional E-value: 2.8e-46 bMERB_dom 2 qreleeieeelkeleergvelEkkLReseegeeeeeelleewfeLvneknalvrreseLvilakeqeLeeeqaeleqelrellekedsekte 93 qr+l++ie++l++le rgvelEk+LR +eg+ +e+ l+ +wf L++ek+ l+rreseL++ +k+q Lee+q +l+ elr+l+ek++ k++ SwissProt::D3ZEN0 852 QRQLQDIERQLDALELRGVELEKRLR-AAEGDASEDGLMVDWFRLIHEKQLLLRRESELMYKSKDQCLEERQLDLQGELRRLMEKPEGLKSP 942 9*************************.5899************************************************************* PP bMERB_dom 94 edkkreeelleelveiVekRdelvesleedrlreeeedee 133 +d+kre+ell+++v++V++R+++v++l+edrlre+eed++ SwissProt::D3ZEN0 943 QDRKREQELLNQYVNTVNDRSDIVDNLDEDRLREQEEDQM 982 **************************************97 PP
Or compare SwissProt::D3ZEN0 to CDD or PaperBLAST