PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::D3ZQL6 to PF12130 (DUF3585)

SwissProt::D3ZQL6 has 855 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    7.7e-49  151.5  13.4    1.2e-48  150.9  13.4    1.3  1  SwissProt::D3ZQL6  


Domain annotation for each sequence (and alignments):
>> SwissProt::D3ZQL6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  150.9  13.4   1.2e-48   1.2e-48       2     135 ..     677     807 ..     676     808 .. 0.97

  Alignments for each domain:
  == domain 1  score: 150.9 bits;  conditional E-value: 1.2e-48
            DUF3585   2 qreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeK 93 
                          e++ ie+++++le+ gv lE++LR   +  +e +e+++l +wf+L++ek+ lvrreseL+++ ++q+Le++qad+e elr+l++k+ek++
  SwissProt::D3ZQL6 677 YGEMDSIERQLDALEHSGVLLEEKLR---GGANEGSEDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDW 765
                        679***********************...5456999******************************************************** PP

            DUF3585  94 teedkereeelleelvevVeqRdelvdsleedrlreaeedee 135
                        t++d++re+ l++el++++eqRd++v++l+edr+re+eed++
  SwissProt::D3ZQL6 766 TDDDRAREKVLMQELMTLIEQRDAIVNCLDEDRQREEEEDKM 807
                        ****************************************97 PP



Or compare SwissProt::D3ZQL6 to CDD or PaperBLAST