SwissProt::D3ZQL6 has 855 amino acids
Query: bMERB_dom [M=134] Accession: PF12130.12 Description: Bivalent Mical/EHBP Rab binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-49 151.1 13.2 1.5e-48 150.5 13.2 1.3 1 SwissProt::D3ZQL6 Domain annotation for each sequence (and alignments): >> SwissProt::D3ZQL6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 150.5 13.2 1.5e-48 1.5e-48 2 133 .. 677 807 .. 676 808 .. 0.97 Alignments for each domain: == domain 1 score: 150.5 bits; conditional E-value: 1.5e-48 bMERB_dom 2 qreleeieeelkeleergvelEkkLReseegeeeeeelleewfeLvneknalvrreseLvilakeqeLeeeqaeleqelrellekedsekte 93 e++ ie++l++le++gv lE+kLR+ ++e +e+++l +wf+L++ek+ lvrreseL ++ k+q+Le++qa++e elr+ll+k+++++t+ SwissProt::D3ZQL6 677 YGEMDSIERQLDALEHSGVLLEEKLRG-GANEGSEDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDWTD 767 679***********************5.7889************************************************************ PP bMERB_dom 94 edkkreeelleelveiVekRdelvesleedrlreeeedee 133 +d++re+ l++el++++e+Rd++v++l+edr+reeeed++ SwissProt::D3ZQL6 768 DDRAREKVLMQELMTLIEQRDAIVNCLDEDRQREEEEDKM 807 **************************************97 PP
Or compare SwissProt::D3ZQL6 to CDD or PaperBLAST