PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::E1BBG2 to PF12130 (DUF3585)

SwissProt::E1BBG2 has 853 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      3e-49  152.9  15.5    5.5e-49  152.0  15.5    1.4  1  SwissProt::E1BBG2  


Domain annotation for each sequence (and alignments):
>> SwissProt::E1BBG2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  152.0  15.5   5.5e-49   5.5e-49       1     135 [.     674     805 ..     674     806 .. 0.97

  Alignments for each domain:
  == domain 1  score: 152.0 bits;  conditional E-value: 5.5e-49
            DUF3585   1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeeke 92 
                        i+ e++ ie+++++le+rgv lE++LR   +  +e +e+++l +wf+L++ek+ lvrreseL+++ ++q+Le++qad+e+elr+l++k+ek+
  SwissProt::E1BBG2 674 IHGEIDTIERQLDALEHRGVLLEEKLR---GGVNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKD 762
                        678999*********************...6567999******************************************************* PP

            DUF3585  93 KteedkereeelleelvevVeqRdelvdsleedrlreaeedee 135
                        +teed+ re+ l++elv+++eqR+++v++l+edr+re+eed++
  SwissProt::E1BBG2 763 WTEEDRGREKVLMQELVTLIEQRNAIVNCLDEDRQREEEEDKM 805
                        *****************************************97 PP



Or compare SwissProt::E1BBG2 to CDD or PaperBLAST