SwissProt::E1BBG2 has 853 amino acids
Query: bMERB_dom [M=134] Accession: PF12130.12 Description: Bivalent Mical/EHBP Rab binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.4e-49 151.5 15.2 1.3e-48 150.7 15.2 1.4 1 SwissProt::E1BBG2 Domain annotation for each sequence (and alignments): >> SwissProt::E1BBG2 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 150.7 15.2 1.3e-48 1.3e-48 1 133 [. 674 805 .. 674 806 .. 0.97 Alignments for each domain: == domain 1 score: 150.7 bits; conditional E-value: 1.3e-48 bMERB_dom 1 iqreleeieeelkeleergvelEkkLReseegeeeeeelleewfeLvneknalvrreseLvilakeqeLeeeqaeleqelrellekedsekt 92 i+ e++ ie++l++le+rgv lE+kLR+ +e +e+++l +wf+L++ek+ lvrreseL ++ k+q+Le++qa++e+elr+ll+k+++++t SwissProt::E1BBG2 674 IHGEIDTIERQLDALEHRGVLLEEKLRG-GVNEGREDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWT 764 567999*********************5.788************************************************************ PP bMERB_dom 93 eedkkreeelleelveiVekRdelvesleedrlreeeedee 133 eed+ re+ l++elv+++e+R+++v++l+edr+reeeed++ SwissProt::E1BBG2 765 EEDRGREKVLMQELVTLIEQRNAIVNCLDEDRQREEEEDKM 805 ***************************************97 PP
Or compare SwissProt::E1BBG2 to CDD or PaperBLAST