PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q3TN34 to PF12130 (DUF3585)

SwissProt::Q3TN34 has 1009 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      2e-44  137.3  20.6    2.9e-44  136.7  20.6    1.3  1  SwissProt::Q3TN34  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q3TN34  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  136.7  20.6   2.9e-44   2.9e-44       2     135 ..     847     977 ..     846     978 .. 0.97

  Alignments for each domain:
  == domain 1  score: 136.7 bits;  conditional E-value: 2.9e-44
            DUF3585   2 qreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeK 93 
                        qr+l++ie ++++le rgvelEk+LR   + +g+ +e++l+ +wf+L++ek+ l+r eseLm+ +++q+Le++q dl+ elr+lm+k+e  K
  SwissProt::Q3TN34 847 QRQLQDIESQLDALELRGVELEKRLR---AAEGDASEDSLMVDWFRLIHEKQLLLRLESELMYKSKDQRLEEQQLDLQGELRRLMDKPEGLK 935
                        9*************************...44679********************************************************** PP

            DUF3585  94 teedkereeelleelvevVeqRdelvdsleedrlreaeedee 135
                        +++d++re+ell+++v+ V++R+ +vd l+edrlre+eed++
  SwissProt::Q3TN34 936 SPQDRQREQELLSQYVNTVNDRSDIVDFLDEDRLREQEEDQM 977
                        ****************************************97 PP



Or compare SwissProt::Q3TN34 to CDD or PaperBLAST