PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8BGT6 to PF12130 (DUF3585)

SwissProt::Q8BGT6 has 870 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
      6e-49  151.9  14.4      9e-49  151.3  14.4    1.3  1  SwissProt::Q8BGT6  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8BGT6  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  151.3  14.4     9e-49     9e-49       2     135 ..     692     822 ..     691     823 .. 0.97

  Alignments for each domain:
  == domain 1  score: 151.3 bits;  conditional E-value: 9e-49
            DUF3585   2 qreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeK 93 
                          e+++ie+++++le+ gv lE++LR   +  +e +e+++l +wf+L++ek+ lvrreseL+++ ++q+Le++qad+e elr+l++k+ek++
  SwissProt::Q8BGT6 692 YGEMDNIERQLDALEHSGVLLEEKLR---GGANEGSEDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDW 780
                        679***********************...5456999******************************************************** PP

            DUF3585  94 teedkereeelleelvevVeqRdelvdsleedrlreaeedee 135
                        t+ed++re+ l++el++++eqRd++v++l+edr+re+eed++
  SwissProt::Q8BGT6 781 TDEDRAREKVLMQELMTLIEQRDAIVNCLDEDRQREEEEDKM 822
                        ****************************************97 PP



Or compare SwissProt::Q8BGT6 to CDD or PaperBLAST