SwissProt::Q8BGT6 has 870 amino acids
Query: bMERB_dom [M=134] Accession: PF12130.12 Description: Bivalent Mical/EHBP Rab binding domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.1e-49 151.3 14.3 1.2e-48 150.8 14.3 1.3 1 SwissProt::Q8BGT6 Domain annotation for each sequence (and alignments): >> SwissProt::Q8BGT6 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 150.8 14.3 1.2e-48 1.2e-48 2 133 .. 692 822 .. 691 823 .. 0.97 Alignments for each domain: == domain 1 score: 150.8 bits; conditional E-value: 1.2e-48 bMERB_dom 2 qreleeieeelkeleergvelEkkLReseegeeeeeelleewfeLvneknalvrreseLvilakeqeLeeeqaeleqelrellekedsekte 93 e+++ie++l++le++gv lE+kLR+ ++e +e+++l +wf+L++ek+ lvrreseL ++ k+q+Le++qa++e elr+ll+k+++++t+ SwissProt::Q8BGT6 692 YGEMDNIERQLDALEHSGVLLEEKLRG-GANEGSEDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDWTD 782 679***********************5.7889************************************************************ PP bMERB_dom 94 edkkreeelleelveiVekRdelvesleedrlreeeedee 133 ed++re+ l++el++++e+Rd++v++l+edr+reeeed++ SwissProt::Q8BGT6 783 EDRAREKVLMQELMTLIEQRDAIVNCLDEDRQREEEEDKM 822 **************************************97 PP
Or compare SwissProt::Q8BGT6 to CDD or PaperBLAST