PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8IY33 to PF12130 (DUF3585)

SwissProt::Q8IY33 has 904 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    7.3e-44  135.4  23.8      1e-43  134.9  23.8    1.2  1  SwissProt::Q8IY33  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8IY33  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  134.9  23.8     1e-43     1e-43       1     135 [.     740     871 ..     740     872 .. 0.98

  Alignments for each domain:
  == domain 1  score: 134.9 bits;  conditional E-value: 1e-43
            DUF3585   1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeeke 92 
                        iqr+l++ie+++++le rgvelEk+LR   + +g++ e++l+ +wf L++ek+ l+r+eseLm+ ++ q+Le++q d+e elr+lmak+e+ 
  SwissProt::Q8IY33 740 IQRQLQDIERRLDALELRGVELEKRLR---AAEGDDAEDSLMVDWFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKPEAL 828
                        8**************************...446799******************************************************** PP

            DUF3585  93 KteedkereeelleelvevVeqRdelvdsleedrlreaeedee 135
                        K+ ++++re+elle++v+ V++R+ +vdsl+edrlre+eed++
  SwissProt::Q8IY33 829 KSLQERRREQELLEQYVSTVNDRSDIVDSLDEDRLREQEEDQM 871
                        *****************************************97 PP



Or compare SwissProt::Q8IY33 to CDD or PaperBLAST