PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8TDZ2 to PF12130 (DUF3585)

SwissProt::Q8TDZ2 has 1067 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    2.2e-37  114.5  21.5    5.5e-37  113.2  21.5    1.7  1  SwissProt::Q8TDZ2  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8TDZ2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  113.2  21.5   5.5e-37   5.5e-37       1     130 [.     931    1059 ..     931    1061 .. 0.97

  Alignments for each domain:
  == domain 1  score: 113.2 bits;  conditional E-value: 5.5e-37
            DUF3585    1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakee 90  
                         iqr+l+eie  +rele++gv+lE aLR++++ s e++++ ++ ++++Lv +kn+lv +e+eLmi+ +e++Le++q++l+qelr +m+ ee
  SwissProt::Q8TDZ2  931 IQRRLNEIEAALRELEAEGVKLELALRRQSS-SPEQQKKLWVGQLLQLVDKKNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREE 1019
                         8**************************8775.78999999************************************************** PP

            DUF3585   91 keKteedkereeelleelvevVeqRdelvdsleedrlrea 130 
                         + Kt +d+++e+++l++lv++V+qRd+l++  ee rl e 
  SwissProt::Q8TDZ2 1020 NLKTAADRQAEDQVLRKLVDLVNQRDALIRFQEERRLSEL 1059
                         ************************************9885 PP



Or compare SwissProt::Q8TDZ2 to CDD or PaperBLAST