PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q8VDP3 to PF12130 (DUF3585)

SwissProt::Q8VDP3 has 1048 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    4.8e-36  110.1  24.8    4.8e-36  110.1  24.8    2.4  2  SwissProt::Q8VDP3  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q8VDP3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -1.8   0.2      0.18      0.18      69     104 ..     874     909 ..     864     911 .. 0.89
   2 !  110.1  24.8   4.8e-36   4.8e-36       1     130 [.     918    1046 ..     918    1048 .] 0.97

  Alignments for each domain:
  == domain 1  score: -1.8 bits;  conditional E-value: 0.18
            DUF3585  69 qeLedeqadleqelrelmakeekeKteedkereeel 104
                         eLe+    l ++  ++++ + +++t   +++eee+
  SwissProt::Q8VDP3 874 PELEQTLLTLAKNPGAMTKYPTWRRTLMRRAKEEEM 909
                        589999999999999999999999999999999986 PP

  == domain 2  score: 110.1 bits;  conditional E-value: 4.8e-36
            DUF3585    1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakee 90  
                         iqr+l+eie ++rele++g +lE aLR+e++ s e++++ +l ++++L+++kn+lv +e+eLmi+ +e++Le++q +l++elr +m+ ee
  SwissProt::Q8VDP3  918 IQRRLNEIEATMRELEAEGTKLELALRKESS-SPEQQKKLWLDQLLRLIQKKNSLVTEEAELMITVQELDLEEKQRQLDHELRGYMNREE 1006
                         8**************************8885.78999999************************************************** PP

            DUF3585   91 keKteedkereeelleelvevVeqRdelvdsleedrlrea 130 
                         + Kte+d + e+++l++l+evV+qRd+l++  ee rlre+
  SwissProt::Q8VDP3 1007 TMKTEADLQSENQVLRKLLEVVNQRDALIQFQEERRLREM 1046
                         **************************************96 PP



Or compare SwissProt::Q8VDP3 to CDD or PaperBLAST