PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001922175.2 to PF12130 (DUF3585)

XP_001922175.2 has 867 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-47  147.7  21.4    1.2e-47  147.7  21.4    2.2  2  XP_001922175.2  


Domain annotation for each sequence (and alignments):
>> XP_001922175.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   1.3     0.017     0.017      16      36 ..     257     278 ..     249     298 .. 0.76
   2 !  147.7  21.4   1.2e-47   1.2e-47       1     134 [.     687     817 ..     687     819 .. 0.97

  Alignments for each domain:
  == domain 1  score: 1.5 bits;  conditional E-value: 0.017
         DUF3585  16 eergvelEkaLRgeae.esgee 36 
                     ee+  elE++LR++++ +s+ e
  XP_001922175.2 257 EEKTSELEERLRKQTDsKSKVE 278
                     8899999999998885333333 PP

  == domain 2  score: 147.7 bits;  conditional E-value: 1.2e-47
         DUF3585   1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKte 95 
                     i+ e++++e++++ele+rgv lEk LR   e s++eeee+ll +wf+L++ek+ lvrre+eL+++a++q+Le++qad+e+elr+l++k+eke+t+
  XP_001922175.2 687 IHVEMSDLEKRLDELEHRGVDLEKSLR---ECSNDEEEEHLLVDWFTLIHEKHLLVRREAELVYTAKQQNLEERQADVEYELRCLLNKPEKEWTS 778
                     6779***********************...435699*********************************************************** PP

         DUF3585  96 edkereeelleelvevVeqRdelvdsleedrlreaeede 134
                     edk+re++l+++lv+++eqR+++v++++ dr+re+eed+
  XP_001922175.2 779 EDKDREKQLMADLVTIIEQRNQIVNNIDIDRQREEEEDK 817
                     **************************************8 PP



Or compare XP_001922175.2 to CDD or PaperBLAST