PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006249037.1 to PF12130 (DUF3585)

XP_006249037.1 has 1006 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    7.5e-45  138.6  20.8    1.1e-44  138.1  20.8    1.3  1  XP_006249037.1  


Domain annotation for each sequence (and alignments):
>> XP_006249037.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  138.1  20.8   1.1e-44   1.1e-44       2     135 ..     844     974 ..     843     975 .. 0.97

  Alignments for each domain:
  == domain 1  score: 138.1 bits;  conditional E-value: 1.1e-44
         DUF3585   2 qreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKtee 96 
                     qr+l++ie+++++le rgvelEk+LR   + +g+ +e+ l+ +wf+L++ek+ l+rreseLm+ +++q Le++q dl+ elr+lm+k+e  K+++
  XP_006249037.1 844 QRQLQDIERQLDALELRGVELEKRLR---AAEGDASEDGLMVDWFRLIHEKQLLLRRESELMYKSKDQCLEERQLDLQGELRRLMEKPEGLKSPQ 935
                     9*************************...446799************************************************************ PP

         DUF3585  97 dkereeelleelvevVeqRdelvdsleedrlreaeedee 135
                     d++re+ell+++v+ V++R+ +vd+l+edrlre+eed++
  XP_006249037.1 936 DRKREQELLNQYVNTVNDRSDIVDNLDEDRLREQEEDQM 974
                     *************************************97 PP



Or compare XP_006249037.1 to CDD or PaperBLAST