PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006512633.1 to PF12130 (DUF3585)

XP_006512633.1 has 1207 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.8e-36  109.9  24.8    5.8e-36  109.9  24.8    2.3  2  XP_006512633.1  


Domain annotation for each sequence (and alignments):
>> XP_006512633.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.0   0.1       0.2       0.2      70     104 ..    1034    1068 ..    1030    1070 .. 0.88
   2 !  109.9  24.8   5.8e-36   5.8e-36       1     130 [.    1077    1205 ..    1077    1207 .] 0.97

  Alignments for each domain:
  == domain 1  score: -2.0 bits;  conditional E-value: 0.2
         DUF3585   70 eLedeqadleqelrelmakeekeKteedkereeel 104 
                      eLe+    l ++  ++++ + +++t   +++eee+
  XP_006512633.1 1034 ELEQTLLTLAKNPGAMTKYPTWRRTLMRRAKEEEM 1068
                      79999999999999999999999999999999986 PP

  == domain 2  score: 109.9 bits;  conditional E-value: 5.8e-36
         DUF3585    1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeK 93  
                      iqr+l+eie ++rele++g +lE aLR+e++ s e++++ +l ++++L+++kn+lv +e+eLmi+ +e++Le++q +l++elr +m+ ee+ K
  XP_006512633.1 1077 IQRRLNEIEATMRELEAEGTKLELALRKESS-SPEQQKKLWLDQLLRLIQKKNSLVTEEAELMITVQELDLEEKQRQLDHELRGYMNREETMK 1168
                      8**************************8885.78999999***************************************************** PP

         DUF3585   94 teedkereeelleelvevVeqRdelvdsleedrlrea 130 
                      te+d + e+++l++l+evV+qRd+l++  ee rlre+
  XP_006512633.1 1169 TEADLQSENQVLRKLLEVVNQRDALIQFQEERRLREM 1205
                      ***********************************96 PP



Or compare XP_006512633.1 to CDD or PaperBLAST