PaperBLAST – Find papers about a protein or its homologs

 

Align XP_011239276.1 to PF12130 (DUF3585)

XP_011239276.1 has 926 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.8e-44  137.4  20.6    2.6e-44  136.9  20.6    1.2  1  XP_011239276.1  


Domain annotation for each sequence (and alignments):
>> XP_011239276.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  136.9  20.6   2.6e-44   2.6e-44       2     135 ..     764     894 ..     763     895 .. 0.97

  Alignments for each domain:
  == domain 1  score: 136.9 bits;  conditional E-value: 2.6e-44
         DUF3585   2 qreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKtee 96 
                     qr+l++ie ++++le rgvelEk+LR   + +g+ +e++l+ +wf+L++ek+ l+r eseLm+ +++q+Le++q dl+ elr+lm+k+e  K+++
  XP_011239276.1 764 QRQLQDIESQLDALELRGVELEKRLR---AAEGDASEDSLMVDWFRLIHEKQLLLRLESELMYKSKDQRLEEQQLDLQGELRRLMDKPEGLKSPQ 855
                     9*************************...44679************************************************************* PP

         DUF3585  97 dkereeelleelvevVeqRdelvdsleedrlreaeedee 135
                     d++re+ell+++v+ V++R+ +vd l+edrlre+eed++
  XP_011239276.1 856 DRQREQELLSQYVNTVNDRSDIVDFLDEDRLREQEEDQM 894
                     *************************************97 PP



Or compare XP_011239276.1 to CDD or PaperBLAST