PaperBLAST – Find papers about a protein or its homologs

 

Align XP_011513826.1 to PF12130 (DUF3585)

XP_011513826.1 has 497 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.9e-44  136.7  23.8    3.9e-44  136.3  23.8    1.2  1  XP_011513826.1  


Domain annotation for each sequence (and alignments):
>> XP_011513826.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  136.3  23.8   3.9e-44   3.9e-44       1     135 [.     169     300 ..     169     301 .. 0.98

  Alignments for each domain:
  == domain 1  score: 136.3 bits;  conditional E-value: 3.9e-44
         DUF3585   1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKte 95 
                     iqr+l++ie+++++le rgvelEk+LR   + +g++ e++l+ +wf L++ek+ l+r+eseLm+ ++ q+Le++q d+e elr+lmak+e+ K+ 
  XP_011513826.1 169 IQRQLQDIERRLDALELRGVELEKRLR---AAEGDDAEDSLMVDWFWLIHEKQLLLRQESELMYKSKAQRLEEQQLDIEGELRRLMAKPEALKSL 260
                     8**************************...446799*********************************************************** PP

         DUF3585  96 edkereeelleelvevVeqRdelvdsleedrlreaeedee 135
                     ++++re+elle++v+ V++R+ +vdsl+edrlre+eed++
  XP_011513826.1 261 QERRREQELLEQYVSTVNDRSDIVDSLDEDRLREQEEDQM 300
                     **************************************97 PP



Or compare XP_011513826.1 to CDD or PaperBLAST