PaperBLAST – Find papers about a protein or its homologs

 

Align XP_013969819.1 to PF12130 (DUF3585)

XP_013969819.1 has 788 amino acids

Query:       DUF3585  [M=136]
Accession:   PF12130.8
Description: Bivalent Mical/EHBP Rab binding domain
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.7e-43  134.2  19.7    2.4e-43  133.7  19.7    1.2  1  XP_013969819.1  


Domain annotation for each sequence (and alignments):
>> XP_013969819.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  133.7  19.7   2.4e-43   2.4e-43       1     135 [.     619     750 ..     619     751 .. 0.98

  Alignments for each domain:
  == domain 1  score: 133.7 bits;  conditional E-value: 2.4e-43
         DUF3585   1 iqreleeieeeqreleergvelEkaLRgeaeesgeeeeeellqewfeLvneknelvrreseLmilareqeLedeqadleqelrelmakeekeKte 95 
                     iqr +++ie++++ le rgvelEk+LR   + +g+ +e++l+ +wf+L+++k+ l+r+eseLm+ ar+q+L +eq++le elr+lmak+e+ K++
  XP_013969819.1 619 IQRHMQDIERQLDVLELRGVELEKRLR---AAEGDASEDTLMVDWFQLIHKKQLLLRQESELMYKARDQQLAEEQSNLEGELRQLMAKPESLKSP 710
                     89*************************...44679************************************************************ PP

         DUF3585  96 edkereeelleelvevVeqRdelvdsleedrlreaeedee 135
                      d++re  ll+++++ Ve+R+++vd leedrlre eede+
  XP_013969819.1 711 LDQQREADLLSRYISTVEDRSNIVDVLEEDRLRELEEDEM 750
                     **************************************97 PP



Or compare XP_013969819.1 to CDD or PaperBLAST