PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::P51112 to PF12372 (DUF3652)

SwissProt::P51112 has 3148 amino acids

Query:       DUF3652  [M=41]
Accession:   PF12372.8
Description: Huntingtin protein region
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.6e-24   71.9   0.9    1.6e-24   71.9   0.9    3.1  3  SwissProt::P51112  


Domain annotation for each sequence (and alignments):
>> SwissProt::P51112  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -3.6   0.0      0.61      0.61      22      30 ..     787     795 ..     786     811 .. 0.85
   2 !   71.9   0.9   1.6e-24   1.6e-24       1      41 []    1508    1548 ..    1508    1548 .. 0.98
   3 ?   -1.7   0.1      0.16      0.16       8      20 ..    2860    2873 ..    2857    2879 .. 0.71

  Alignments for each domain:
  == domain 1  score: -3.6 bits;  conditional E-value: 0.61
            DUF3652  22 alrheipal 30 
                        a+rh+i  l
  SwissProt::P51112 787 AVRHCIMSL 795
                        89****876 PP

  == domain 2  score: 71.9 bits;  conditional E-value: 1.6e-24
            DUF3652    1 aiigiPrIiqLcdglmASgqpalrheipalrpivqDlffyr 41  
                         +ii iP+IiqLcdg+mASg++a++h+ipal+piv+Dlf++r
  SwissProt::P51112 1508 QIISIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLR 1548
                         69*************************************98 PP

  == domain 3  score: -1.7 bits;  conditional E-value: 0.16
            DUF3652    8 IiqLcdglm..ASgq 20  
                         IiqLc g+m  AS++
  SwissProt::P51112 2860 IIQLC-GVMvsASED 2873
                         9****.777445555 PP



Or compare SwissProt::P51112 to CDD or PaperBLAST