PaperBLAST – Find papers about a protein or its homologs

 

Align XP_001364862.1 to PF12372 (DUF3652)

XP_001364862.1 has 3135 amino acids

Query:       DUF3652  [M=41]
Accession:   PF12372.8
Description: Huntingtin protein region
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.2e-25   74.1   0.7    3.2e-25   74.1   0.7    2.3  2  XP_001364862.1  


Domain annotation for each sequence (and alignments):
>> XP_001364862.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.1   0.7   3.2e-25   3.2e-25       1      41 []    1506    1546 ..    1506    1546 .. 0.98
   2 ?   -3.0   0.1      0.39      0.39      27      38 ..    2377    2389 ..    2376    2390 .. 0.89

  Alignments for each domain:
  == domain 1  score: 74.1 bits;  conditional E-value: 3.2e-25
         DUF3652    1 aiigiPrIiqLcdglmASgqpalrheipalrpivqDlffyr 41  
                      +iigiP+IiqLcdg+mASg++a++h+ipal+piv+Dlf++r
  XP_001364862.1 1506 QIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLR 1546
                      69*************************************98 PP

  == domain 2  score: -3.0 bits;  conditional E-value: 0.39
         DUF3652   27 ipal.rpivqDlf 38  
                      ipa+  p++++++
  XP_001364862.1 2377 IPAFlTPVLKNII 2389
                      89988*******9 PP



Or compare XP_001364862.1 to CDD or PaperBLAST