PaperBLAST – Find papers about a protein or its homologs

 

Align XP_005093645.2 to PF12372 (DUF3652)

XP_005093645.2 has 3024 amino acids

Query:       DUF3652  [M=41]
Accession:   PF12372.8
Description: Huntingtin protein region
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    5.6e-20   57.4   0.3    5.6e-20   57.4   0.3    2.4  2  XP_005093645.2  


Domain annotation for each sequence (and alignments):
>> XP_005093645.2  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.7   0.2      0.33      0.33      23      32 ..     259     268 ..     258     271 .. 0.86
   2 !   57.4   0.3   5.6e-20   5.6e-20       1      41 []    1375    1415 ..    1375    1415 .. 0.98

  Alignments for each domain:
  == domain 1  score: -2.7 bits;  conditional E-value: 0.33
         DUF3652  23 lrheipalrp 32 
                     lrh ip l p
  XP_005093645.2 259 LRHSIPHLAP 268
                     79******98 PP

  == domain 2  score: 57.4 bits;  conditional E-value: 5.6e-20
         DUF3652    1 aiigiPrIiqLcdglmASgqpalrheipalrpivqDlffyr 41  
                      +ii +PrIi+ cdg+mASg ++++h+ipalrp+v +lf++r
  XP_005093645.2 1375 SIIDMPRIIHRCDGIMASGLQPTTHAIPALRPVVYELFLLR 1415
                      69************************************998 PP



Or compare XP_005093645.2 to CDD or PaperBLAST