PaperBLAST – Find papers about a protein or its homologs

 

Align XP_005160073.1 to PF12372 (DUF3652)

XP_005160073.1 has 3115 amino acids

Query:       DUF3652  [M=41]
Accession:   PF12372.8
Description: Huntingtin protein region
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    1.2e-24   72.3   3.9    1.6e-24   71.9   0.9    3.0  2  XP_005160073.1  


Domain annotation for each sequence (and alignments):
>> XP_005160073.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.0   0.1      0.19      0.19      21      30 ..     780     789 ..     779     793 .. 0.88
   2 !   71.9   0.9   1.6e-24   1.6e-24       1      41 []    1487    1527 ..    1487    1527 .. 0.98

  Alignments for each domain:
  == domain 1  score: -2.0 bits;  conditional E-value: 0.19
         DUF3652  21 palrheipal 30 
                     +a+rh+i al
  XP_005160073.1 780 AAVRHCIMAL 789
                     599****998 PP

  == domain 2  score: 71.9 bits;  conditional E-value: 1.6e-24
         DUF3652    1 aiigiPrIiqLcdglmASgqpalrheipalrpivqDlffyr 41  
                      +ii iP+IiqLcdg+mASg++a++h+ipal+piv+Dlf++r
  XP_005160073.1 1487 QIISIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLR 1527
                      69*************************************98 PP



Or compare XP_005160073.1 to CDD or PaperBLAST