PaperBLAST – Find papers about a protein or its homologs

 

Align XP_006822985.1 to PF12372 (DUF3652)

XP_006822985.1 has 2816 amino acids

Query:       DUF3652  [M=41]
Accession:   PF12372.8
Description: Huntingtin protein region
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    3.6e-26   77.2   0.6    9.4e-26   75.8   0.6    1.8  1  XP_006822985.1  


Domain annotation for each sequence (and alignments):
>> XP_006822985.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   75.8   0.6   9.4e-26   9.4e-26       1      41 []    1471    1511 ..    1471    1511 .. 0.98

  Alignments for each domain:
  == domain 1  score: 75.8 bits;  conditional E-value: 9.4e-26
         DUF3652    1 aiigiPrIiqLcdglmASgqpalrheipalrpivqDlffyr 41  
                      aiig+P+IiqLcdg+mASgq+a +h+ipalrpiv+Dlf++r
  XP_006822985.1 1471 AIIGMPKIIQLCDGIMASGQQASTHAIPALRPIVHDLFVLR 1511
                      7**************************************98 PP



Or compare XP_006822985.1 to CDD or PaperBLAST