PaperBLAST – Find papers about a protein or its homologs

 

Align XP_008248081.1 to PF12372 (DUF3652)

XP_008248081.1 has 3053 amino acids

Query:       DUF3652  [M=41]
Accession:   PF12372.8
Description: Huntingtin protein region
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
      7e-26   76.2   0.7    3.1e-25   74.2   0.7    2.3  1  XP_008248081.1  


Domain annotation for each sequence (and alignments):
>> XP_008248081.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.2   0.7   3.1e-25   3.1e-25       1      41 []    1426    1466 ..    1426    1466 .. 0.98

  Alignments for each domain:
  == domain 1  score: 74.2 bits;  conditional E-value: 3.1e-25
         DUF3652    1 aiigiPrIiqLcdglmASgqpalrheipalrpivqDlffyr 41  
                      +iigiP+IiqLcdg+mASg++a++h+ipal+piv+Dlf++r
  XP_008248081.1 1426 QIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLR 1466
                      69*************************************98 PP



Or compare XP_008248081.1 to CDD or PaperBLAST