PaperBLAST – Find papers about a protein or its homologs

 

Align XP_420822.3 to PF12372 (DUF3652)

XP_420822.3 has 3095 amino acids

Query:       DUF3652  [M=41]
Accession:   PF12372.8
Description: Huntingtin protein region
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    6.3e-26   76.4   1.8    3.1e-25   74.2   0.7    2.9  2  XP_420822.3  


Domain annotation for each sequence (and alignments):
>> XP_420822.3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.2   0.7   3.1e-25   3.1e-25       1      41 []    1467    1507 ..    1467    1507 .. 0.98
   2 ?   -1.6   0.0      0.14      0.14      26      38 ..    2336    2349 ..    2334    2350 .. 0.88

  Alignments for each domain:
  == domain 1  score: 74.2 bits;  conditional E-value: 3.1e-25
      DUF3652    1 aiigiPrIiqLcdglmASgqpalrheipalrpivqDlffyr 41  
                   +iigiP+IiqLcdg+mASg++a++h+ipal+piv+Dlf++r
  XP_420822.3 1467 QIIGIPKIIQLCDGIMASGRKAVTHAIPALQPIVHDLFVLR 1507
                   69*************************************98 PP

  == domain 2  score: -1.6 bits;  conditional E-value: 0.14
      DUF3652   26 eipal.rpivqDlf 38  
                    ipa+  p++++++
  XP_420822.3 2336 SIPAFlTPVLKNII 2349
                   799999*******9 PP



Or compare XP_420822.3 to CDD or PaperBLAST