VIMSS3495264 has 878 amino acids
Query: Cmr2_N [M=111] Accession: PF12469.12 Description: CRISPR-associated protein Cmr2, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.5e-26 77.4 0.0 1e-25 76.3 0.0 1.6 1 VIMSS3495264 Domain annotation for each sequence (and alignments): >> VIMSS3495264 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 76.3 0.0 1e-25 1e-25 1 104 [. 193 319 .. 193 324 .. 0.87 Alignments for each domain: == domain 1 score: 76.3 bits; conditional E-value: 1e-25 Cmr2_N 1 lvvvsigpVqefIaaaRktrDlWagSwllSylawkaieelveeyGpdvliyPslrgnplvdawlee.......................klse..el 72 l++++i+++q++I++aRk++D++agS+l+S +w ++++ +++ Gpdvl++Ps+r+np+++ l+ VIMSS3495264 193 LLEIDIPGIQKVISSARKAGDYRAGSMLVSLAIWGTAWRYMDKHGPDVLLSPSPRFNPFLYLQLRRlygwgesalrlyrkvagmalgadV--AalLD 287 689**************************************************************9998888888877766666666552..04477 PP Cmr2_N 73 ktallpnkfvlilpkekeaeelaeeiekalke 104 kt+l+p ++ l lp++++ae++ e++e+al e VIMSS3495264 288 KTPLVPGTAYLALPSCSDAERAVEHFEDALDE 319 8***************9888777777766654 PP
Or compare VIMSS3495264 to CDD or PaperBLAST