PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS3495264 to PF12469 (DUF3692)

VIMSS3495264 has 878 amino acids

Query:       DUF3692  [M=111]
Accession:   PF12469.8
Description: CRISPR-associated protein
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
      3e-25   74.9   0.0    6.8e-25   73.7   0.0    1.6  1  VIMSS3495264  


Domain annotation for each sequence (and alignments):
>> VIMSS3495264  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   73.7   0.0   6.8e-25   6.8e-25       1     104 [.     193     319 ..     193     324 .. 0.85

  Alignments for each domain:
  == domain 1  score: 73.7 bits;  conditional E-value: 6.8e-25
                   EEEEEEEESHHHHHS-SSHHHHHHHHHHHHHHHHHHHHHHHHHT-GGGEEES--TT-HHHHHHTS-...................--GG......GG CS
       DUF3692   1 llvvsigpVqefIaaaRktrDlWagSyllSylawkaikelvekyGpdvliyPslrgnplvdawlle...................klee......el 72 
                   ll+++i+++q++I++aRk++D+ agS+l+S  +w ++++ ++k Gpdvl++Ps+r np+++  l+                                
  VIMSS3495264 193 LLEIDIPGIQKVISSARKAGDYRAGSMLVSLAIWGTAWRYMDKHGPDVLLSPSPRFNPFLYLQLRRlygwgesalrlyrkvagmaL--GadvaalLD 287
                   689**************************************************************988888777776665555550..055555588 PP

                   GSB---SEEEEEEE.TTTHHHHHHHHHHHHHH CS
       DUF3692  73 etalipnrfvlilpkeeeaeelaeeveealke 104
                   +t+l+p ++ l lp++++ae++ e++e+al e
  VIMSS3495264 288 KTPLVPGTAYLALPSCSDAERAVEHFEDALDE 319
                   9***************9877666666655543 PP



Or compare VIMSS3495264 to CDD or PaperBLAST