PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7321354 to PF12469 (DUF3692)

VIMSS7321354 has 898 amino acids

Query:       DUF3692  [M=111]
Accession:   PF12469.8
Description: CRISPR-associated protein
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    1.5e-28   85.5   0.0    3.2e-28   84.5   0.0    1.6  1  VIMSS7321354  


Domain annotation for each sequence (and alignments):
>> VIMSS7321354  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   84.5   0.0   3.2e-28   3.2e-28       2     108 ..     157     284 ..     156     287 .. 0.83

  Alignments for each domain:
  == domain 1  score: 84.5 bits;  conditional E-value: 3.2e-28
                   EEEEEEESHHHHHS-SSHHHHHHHHHHHHHHHHHHHHHHHHHT-GGGEEES--TT-HHHHHHTS-......--GG................GGGSB- CS
       DUF3692   2 lvvsigpVqefIaaaRktrDlWagSyllSylawkaikelvekyGpdvliyPslrgnplvdawlle......klee................eletal 76 
                   ++ ++++Vq+f+ a+Rk++D+WagS+ lS  +w +++++vekyGpdvl++P++r np++  +++       k  +                   ++l
  VIMSS7321354 157 VNADVPGVQDFVGAGRKAGDFWAGSWALSIAVWLTAWPFVEKYGPDVLLRPTARLNPYYFYFIRGssqkldK--HlrdvmrevgftppepaWIMQPL 251
                   7889***********************************************************985555550..0555555566666666699**** PP

                   --SEEEEEEE.TT.THHHHHHHHHHHHHHHHHH CS
       DUF3692  77 ipnrfvlilpkee.eaeelaeeveealkeawke 108
                   i+++++l+lp+   ++ee+ +ev e +k+a++ 
  VIMSS7321354 252 IGEKIQLVLPRRWsSEEEVVREVVEGFKKALDC 284
                   **********87744458888888888887765 PP



Or compare VIMSS7321354 to CDD or PaperBLAST