WP_012349925.1 has 898 amino acids
Query: Cmr2_N [M=111] Accession: PF12469.12 Description: CRISPR-associated protein Cmr2, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-28 84.2 0.0 7.8e-28 83.1 0.0 1.6 1 WP_012349925.1 Domain annotation for each sequence (and alignments): >> WP_012349925.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 83.1 0.0 7.8e-28 7.8e-28 2 107 .. 157 283 .. 156 287 .. 0.83 Alignments for each domain: == domain 1 score: 83.1 bits; conditional E-value: 7.8e-28 Cmr2_N 2 vvvsigpVqefIaaaRktrDlWagSwllSylawkaieelveeyGpdvliyPslrgnplvdawlee.....klse.................elkt 74 v+ ++++Vq+f+ a+Rk++D+WagSw lS +w +++++ve+yGpdvl++P++r np++ +++ + + + + WP_012349925.1 157 VNADVPGVQDFVGAGRKAGDFWAGSWALSIAVWLTAWPFVEKYGPDVLLRPTARLNPYYFYFIRGssqklD--KhlrdvmrevgftppepaWIMQ 249 7889**********************************************************998555550..055555666666666666999* PP Cmr2_N 75 allpnkfvlilpkek.eaeelaeeiekalkeawk 107 +l+ +k+ l+lp+ ++ee+ +e+ + +k+a++ WP_012349925.1 250 PLIGEKIQLVLPRRWsSEEEVVREVVEGFKKALD 283 ************7764445888888888887766 PP
Or compare WP_012349925.1 to CDD or PaperBLAST