WP_013175521.1 has 524 amino acids
Query: Cmr2_N [M=111] Accession: PF12469.12 Description: CRISPR-associated protein Cmr2, N-terminal Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.9e-11 30.3 0.0 1.3e-10 27.6 0.0 2.2 2 WP_013175521.1 Domain annotation for each sequence (and alignments): >> WP_013175521.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 27.6 0.0 1.3e-10 1.3e-10 2 58 .. 5 60 .. 4 104 .. 0.86 2 ? -0.4 0.0 0.065 0.065 37 68 .. 186 217 .. 177 270 .. 0.65 Alignments for each domain: == domain 1 score: 27.6 bits; conditional E-value: 1.3e-10 Cmr2_N 2 vvvsigpVqefIaaaRktrDlWagSwllSylawkaieelveeyGpdvliyPslrgnp 58 +++igp+ + + aR t+ lWa+S+l+Sy+++ ++++l e + ++ +P++++n WP_013175521.1 5 FGITIGPIYGTMSLARDTGGLWAASYLFSYISHCLVQRLRE-FPRVSVFSPNPEANR 60 579******************************99999874.445577777777764 PP == domain 2 score: -0.4 bits; conditional E-value: 0.065 Cmr2_N 37 ieelveeyGpdvliyPslrgnplvdawleekl 68 + ++ ++G +++Psl++ ++++ ++++ WP_013175521.1 186 SRMFAGAFGVGKFVFPSLTDIAKTETTRRKEK 217 556777888889999*9999887777777632 PP
Or compare WP_013175521.1 to CDD or PaperBLAST