PaperBLAST – Find papers about a protein or its homologs

 

Align WP_014513846.1 to PF12469 (DUF3692)

WP_014513846.1 has 882 amino acids

Query:       DUF3692  [M=111]
Accession:   PF12469.8
Description: CRISPR-associated protein
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.1e-32   97.9   0.3    5.5e-32   96.6   0.3    1.8  1  WP_014513846.1  


Domain annotation for each sequence (and alignments):
>> WP_014513846.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   96.6   0.3   5.5e-32   5.5e-32       2     111 .]     190     315 ..     189     315 .. 0.90

  Alignments for each domain:
  == domain 1  score: 96.6 bits;  conditional E-value: 5.5e-32
                     EEEEEEESHHHHHS-SSHHHHHHHHHHHHHHHHHHHHHHHHHT-GGGEEES--TT-HHHHHHTS-.................--GGGGGSB---S CS
         DUF3692   2 lvvsigpVqefIaaaRktrDlWagSyllSylawkaikelvekyGpdvliyPslrgnplvdawlle.................kleeeletalipn 79 
                     +v++++ +qefI+ +Rk+rDlWa+S+l S+l+wk i+e++ekyGpdv ++P+l+ n+++ awl +                  l++ +++ ++ +
  WP_014513846.1 190 AVLEFPSIQEFISISRKSRDLWASSWLPSALLWKSIEEFIEKYGPDVALRPELSLNHFFIAWLYNkvqnsksevkkyaekyaGLKDDPRISMMSE 284
                     5789************************************************************9777777766666666665556********* PP

                     EEEEEEE.TTTHHHHHHHHHHHHHHHHHHHHH CS
         DUF3692  80 rfvlilpkeeeaeelaeeveealkeawkeiae 111
                     +++l+lp+++  ++++++++e++ +awk+iae
  WP_014513846.1 285 KVILLLPEDD-TNKIKDRLRENFYKAWKSIAE 315
                     *******766.79****************985 PP



Or compare WP_014513846.1 to CDD or PaperBLAST