WP_015580868.1 has 825 amino acids
Query: Cmr2_N [M=111]
Accession: PF12469.12
Description: CRISPR-associated protein Cmr2, N-terminal
Scores for complete sequences (score includes all domains):
--- full sequence --- --- best 1 domain --- -#dom-
E-value score bias E-value score bias exp N Sequence Description
------- ------ ----- ------- ------ ----- ---- -- -------- -----------
7.4e-27 79.9 0.1 1.8e-26 78.7 0.1 1.6 1 WP_015580868.1
Domain annotation for each sequence (and alignments):
>> WP_015580868.1
# score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc
--- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ----
1 ! 78.7 0.1 1.8e-26 1.8e-26 1 110 [. 204 320 .. 204 324 .. 0.85
Alignments for each domain:
== domain 1 score: 78.7 bits; conditional E-value: 1.8e-26
Cmr2_N 1 lvvvsigpVqefIaaaRktrDlWagSwllSylawkaieelveeyGpdvliyPslrgnplvdawlee....klse............elktallpn 79
lv+++++ +q++I++aRk+ D+W gS+llS+l+++++e+l+++yG d++++P + np++ + l+ + + e++++l+p+
WP_015580868.1 204 LVKIDLPAIQQIISKARKAWDFWGGSYLLSWLTYETVEPLIQKYGVDIVLSPFMGLNPFFVSRLNLpkkiE--DentywefndlmfEPTQPLMPA 296
799*********************************************************99998555551..2455666666888********* PP
Cmr2_N 80 kfvlilpkekeaeelaeeiekalkeawkeia 110
++++ lp+ + ++++ +++aw++i+
WP_015580868.1 297 TVLMALPEYE-------NLKDLYEKAWEKIV 320
*******665.......45556666666665 PP
Or compare WP_015580868.1 to CDD or PaperBLAST