PaperBLAST – Find papers about a protein or its homologs

 

Align WP_015580868.1 to PF12469 (DUF3692)

WP_015580868.1 has 825 amino acids

Query:       DUF3692  [M=111]
Accession:   PF12469.8
Description: CRISPR-associated protein
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    2.8e-26   78.2   0.0    7.3e-26   76.9   0.0    1.7  1  WP_015580868.1  


Domain annotation for each sequence (and alignments):
>> WP_015580868.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   76.9   0.0   7.3e-26   7.3e-26       1     110 [.     204     320 ..     204     327 .. 0.85

  Alignments for each domain:
  == domain 1  score: 76.9 bits;  conditional E-value: 7.3e-26
                     EEEEEEEESHHHHHS-SSHHHHHHHHHHHHHHHHHHHHHHHHHT-GGGEEES--TT-HHHHHHTS-....--GG............GGGSB---S CS
         DUF3692   1 llvvsigpVqefIaaaRktrDlWagSyllSylawkaikelvekyGpdvliyPslrgnplvdawlle....klee............eletalipn 79 
                     l++++++ +q++I++aRk+ D+W gSyllS+l+++++++l++kyG d++++P +  np++   l+     +  +            e++++l+p+
  WP_015580868.1 204 LVKIDLPAIQQIISKARKAWDFWGGSYLLSWLTYETVEPLIQKYGVDIVLSPFMGLNPFFVSRLNLpkkiE--DentywefndlmfEPTQPLMPA 296
                     799*********************************************************99998544341..3666777777888********* PP

                     EEEEEEE.TTTHHHHHHHHHHHHHHHHHHHH CS
         DUF3692  80 rfvlilpkeeeaeelaeeveealkeawkeia 110
                     ++++ lp+ e       ++++ +++aw++i+
  WP_015580868.1 297 TVLMALPEYE-------NLKDLYEKAWEKIV 320
                     *******766.......45555666666665 PP



Or compare WP_015580868.1 to CDD or PaperBLAST