PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::Q16VD3 to PF12478 (DUF3697)

SwissProt::Q16VD3 has 1250 amino acids

Query:       DUF3697  [M=35]
Accession:   PF12478.8
Description: Ubiquitin-associated protein 2
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.4e-25   75.4   1.2    6.8e-25   73.3   0.4    2.5  2  SwissProt::Q16VD3  


Domain annotation for each sequence (and alignments):
>> SwissProt::Q16VD3  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.6   0.0     0.083     0.083       8      18 ..     459     467 ..     458     474 .. 0.66
   2 !   73.3   0.4   6.8e-25   6.8e-25       1      35 []     538     572 ..     538     572 .. 0.98

  Alignments for each domain:
  == domain 1  score: -0.6 bits;  conditional E-value: 0.083
            DUF3697   8 sAVEMPgdsln 18 
                        +A EMP    n
  SwissProt::Q16VD3 459 QALEMPQI--N 467
                        89****54..3 PP

  == domain 2  score: 73.3 bits;  conditional E-value: 6.8e-25
            DUF3697   1 PpSkIPasAVEMPgdslnsissLDVQFGaldFGse 35 
                        PpSkIP+sAVEMPgdsln+i++LDVQFG+ldFG++
  SwissProt::Q16VD3 538 PPSKIPSSAVEMPGDSLNNIGYLDVQFGGLDFGTD 572
                        9********************************97 PP



Or compare SwissProt::Q16VD3 to CDD or PaperBLAST