WP_002967120.1 has 387 amino acids
Query: DUF3987 [M=364] Accession: PF13148.10 Description: Protein of unknown function (DUF3987) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-77 247.3 0.0 1.6e-77 247.1 0.0 1.0 1 WP_002967120.1 Domain annotation for each sequence (and alignments): >> WP_002967120.1 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 247.1 0.0 1.6e-77 1.6e-77 3 318 .. 62 381 .. 60 385 .. 0.96 Alignments for each domain: == domain 1 score: 247.1 bits; conditional E-value: 1.6e-77 DUF3987 3 ppdllalsaLaalSaalqgrvdvepkrgd..replnlytlvvaesGerKSpvdklvtrpleeieeelreeyeeeikeyeaekkawearakalkkk 95 pd++a++aL l++++++r++v pk+ d +e +nl+++v+++++ +K+p+++ ++ p+++i++++r+++++++k ++ + + + +ak+++k+ WP_002967120.1 62 VPDFVAVAALCGLASLIGNRIRVAPKQLDdwIEVPNLWGAVIGPPSAMKTPAMQKALGPVYAIQDDMRKQWQADLKSADIDDVLGKIEAKEATKA 156 59*************************999***************************************************************** PP DUF3987 96 aakakk...eakaeealaeleaeepeePklprllvndaTpeaLlklLaenggsililsdEggiflagigrysggknldvllkawdGepls.vdRk 186 aaka k +++a++ la+l + + e + pr++vndaT e+L++lL+en++++l+++dE+ +fl +++++++++++++l+a++G+ dR+ WP_002967120.1 157 AAKAYKegdKDAARAILADLNNSDDEGQPCPRIVVNDATVEKLGELLNENPRGLLLVRDELPGFLSQMESEDHASDRAFYLEAFNGSGQFtYDRI 251 ***9999*9**************9888889*********************************************************9888**** PP DUF3987 187 gresvhveaprlslllmiQpsvlkella..npgfrgdGllaRf.lfalpdstvgwrdidappipeevle.ayearfrellaeveaeflegelept 277 gr++vh+ ++ ls+++++Qps+++++++ +g+++dGl++R+ l ++pd+ + w+ +d+ +p++ ++ aye++fr+l ++ e + ++p WP_002967120.1 252 GRGTVHIANCTLSIIGGVQPSRIAPIVRgaITGASNDGLIQRLqLTVWPDPCTSWQWVDR--HPDRFAReAYEKVFRDLHEL---ELGSP-DNPV 340 ****************************999*****************************..88888887************...33443.68** PP DUF3987 278 tltlspeAkelfneffneiekrlrpggdledirdwasKlag 318 + +lsp+A+++f+++ +ei+++ r g +++++ K++ WP_002967120.1 341 VFRLSPDAQAMFQQWMQEIQTEARSGKLSTVLESHLLKMPR 381 ***********************99999999*******986 PP
Or compare WP_002967120.1 to CDD or PaperBLAST