PaperBLAST – Find papers about a protein or its homologs

 

Align SwissProt::O32200 to PF13349 (DUF4097)

SwissProt::O32200 has 290 amino acids

Query:       DUF4097  [M=252]
Accession:   PF13349.6
Description: Putative adhesin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------          -----------
    1.9e-60  190.4  10.5    2.2e-60  190.2  10.5    1.0  1  SwissProt::O32200  


Domain annotation for each sequence (and alignments):
>> SwissProt::O32200  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  190.2  10.5   2.2e-60   2.2e-60       1     252 []      48     290 .]      48     290 .] 0.98

  Alignments for each domain:
  == domain 1  score: 190.2 bits;  conditional E-value: 2.2e-60
            DUF4097   1 ikeldissesadvtikesddekitveystakklkkqkveetggtLsitqkekngvstgfikelssgekskitiylPkktkledlqvkassGd 92 
                        i++++i+s s+dv+i+++++++i+  +s++  + +    e+ ++L++t kek++ +      l+ +++s+++++lP ++   dl+v++ssGd
  SwissProt::O32200  48 IDSMVIESDSKDVRIIAEERSDISAGISGDSGKLFVT--ENKRKLELTVKEKEFQF------LNGFNRSTLIVRLPYDY-KGDLAVRTSSGD 130
                        67899******************************76..9***************8......6789*************.************ PP

            DUF4097  93 lsvekatklkaetlelksssGdltlsnvsaktltvksesGdvtiegseakklklqltsGdieleslsletldltsssGdltlsntklegslt 184
                        +sv+++++l+++ l+  s+sG++++++v +++l+vk++sGdv+i+++ +k++ ++l+sGd +l ++s++ ld++++sGd+++  +k++g+++
  SwissProt::O32200 131 VSVAGNDHLALSGLNAVSASGNTSVTDVRIQDLKVKASSGDVSISNTVSKTAGIDLASGDANLVHVSGS-LDVKMTSGDFNAVLKKVTGPVS 221
                        *********************************************************************.********************** PP

            DUF4097 185 itassGdvdlslpeekkaavdassesGdvslpk.kreeeekesnsisaseknakkkvsvstssGDitvk 252
                        +t +sGd+++slp+++++av+a s+sGdvs+p+   ++ +ke+++i+++++++ + ++++t+sGD  ++
  SwissProt::O32200 222 VTLTSGDANVSLPQNGSFAVNALSASGDVSSPYsFADKGHKEQHHITGTQGSGRHPIDIKTDSGDLAIR 290
                        *********************************8889999999**********************9986 PP



Or compare SwissProt::O32200 to CDD or PaperBLAST