PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS104059 to PF13349 (DUF4097)

VIMSS104059 has 280 amino acids

Query:       DUF4097  [M=252]
Accession:   PF13349.6
Description: Putative adhesin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    5.8e-19   54.5  21.3    6.9e-19   54.2  21.3    1.1  1  VIMSS104059  


Domain annotation for each sequence (and alignments):
>> VIMSS104059  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   54.2  21.3   6.9e-19   6.9e-19       1     252 []      45     280 .]      45     280 .] 0.95

  Alignments for each domain:
  == domain 1  score: 54.2 bits;  conditional E-value: 6.9e-19
      DUF4097   1 ikeldissesadvtikesddekitveystakklkkqkveetggtLsitqkekngvstgfikelssgekskitiylPkktkledlqvkassGdlsveka 98 
                  +++ +i++ s++++ik ++  + +v+y +++    +     ++tL+i++k+ ++  + + ++ +  +k+++ti  P+k  ++ l+ ++  G++ ++  
  VIMSS104059  45 FDNVSINLDSTELRIKRGN--QFRVKYDGDNDILINI---VDKTLKISDKRSKTRGYAIDMNPFHENKKTLTIEMPDKM-IKRLNLSSGAGSVRIS-- 134
                  67899************99..99****9999988885...6*********9999888888899****************.****************.. PP

      DUF4097  99 tklkaetlelksssGdltlsnvsaktltvksesGdvtiegseakklklqltsGdieleslsletldltsssGdltlsntklegsltitassGdvdlsl 196
                   ++ +e+++++s  G + ++n  ++ l+ k+++    i+ s +k+++++   G +++++ ++++  +  + Gd+  +n   +   +++++ Gd+++ +
  VIMSS104059 135 -DVDLENTSIQSINGEVVIKNSNLDALDSKTNNSSTYISKSNIKNSNIKVVIGTLQIDKSQIKQSIFLNDHGDIEFKNMPSKVDAKASTKQGDIRFKY 231
                  .*****************************************************************************99999*************** PP

      DUF4097 197 pee.kkaavdassesGdvslpkkreeeekesnsisaseknakkkvsvstssGDitvk 252
                  +++ +++ +++    Gd  +++        +  + ++ +++++++++ t +G+i+v+
  VIMSS104059 232 DSKpEDTILKLNPGTGDSVVKN--------KTFTNGKVGKSDNVLEFYTIDGNIKVE 280
                  9999999999999999999999........6677788999999***********995 PP



Or compare VIMSS104059 to CDD or PaperBLAST