PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS158708 to PF13349 (DUF4097)

VIMSS158708 has 403 amino acids

Query:       DUF4097  [M=252]
Accession:   PF13349.6
Description: Putative adhesin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    1.5e-22   66.3   5.4    1.8e-21   62.7   1.5    3.3  3  VIMSS158708  


Domain annotation for each sequence (and alignments):
>> VIMSS158708  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    2.0   0.0    0.0061    0.0061     116     147 ..     134     165 ..     132     167 .. 0.71
   2 !   62.7   1.5   1.8e-21   1.8e-21       6     197 ..     145     337 ..     140     361 .. 0.80
   3 !    2.1   0.1    0.0056    0.0056     117     143 ..     376     402 ..     368     403 .] 0.84

  Alignments for each domain:
  == domain 1  score: 2.0 bits;  conditional E-value: 0.0061
      DUF4097 116 tlsnvsaktltvksesGdvtiegseakklklq 147
                  +  n+++ ++t+  + Gdv i +   +++k+ 
  VIMSS158708 134 NFDNATFRSFTIRVATGDVIIRSWDKEQMKIR 165
                  55677777888888888887777777777775 PP

  == domain 2  score: 62.7 bits;  conditional E-value: 1.8e-21
      DUF4097   6 issesadvtikesddekitveystakklkkqkveetggtLsitqkekngvstgfik..............elssgekskitiylPkktkledlqvkas 89 
                  i++   dv i+  d+e+++++++ a   k ++         i+q +++  + +f+               + ++  k+ ++i++Pk   +e+++++  
  VIMSS158708 145 IRVATGDVIIRSWDKEQMKIRAVLAVHEKARS---------IRQLSEEKLWDYFFSqtmldispdnftfeSKNELLKTDLVITIPKRL-YEQVKIQLL 232
                  55555566666666666666666655555554.........344333333333333444667777777777888889**********9.********* PP

      DUF4097  90 sGdlsvekatklkaetlelksssGdltlsnvsaktltvksesGdvtiegseakklklqltsGdieleslsletldltsssGdlt..lsntklegslti 185
                  +G+l++    + +ae++++k+  Gd++ s +s+k l+  s++G++ ++ s+ ++++++++ Gdi l++  l+   +++  Gd+   l+ +  +   ++
  VIMSS158708 233 NGNLKYD---DTAAEDAIIKTRHGDIRSSGASGKFLSTESADGEIFFKRSTVENVDMSTAKGDIALQGSFLT-TIAKAAQGDVEyiLE-NDTSSAADL 325
                  *****99...**********************************************************9999.779******984234.4444589** PP

      DUF4097 186 tassGdvdlslp 197
                  +a  Gd+++ +p
  VIMSS158708 326 EAPNGDIRIQIP 337
                  *********998 PP

  == domain 3  score: 2.1 bits;  conditional E-value: 0.0056
      DUF4097 117 lsnvsaktltvksesGdvtiegseakk 143
                   + +s++tl+ k ++G ++++ +e+k+
  VIMSS158708 376 AEEISMATLQAKVGNGIIKVSELETKN 402
                  567889999999999999999999886 PP



Or compare VIMSS158708 to CDD or PaperBLAST