PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS355032 to PF13349 (DUF4097)

VIMSS355032 has 341 amino acids

Query:       DUF4097  [M=252]
Accession:   PF13349.6
Description: Putative adhesin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    9.7e-27   80.0  19.6    1.4e-18   53.2  12.7    2.2  2  VIMSS355032  


Domain annotation for each sequence (and alignments):
>> VIMSS355032  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   53.2  12.7   1.4e-18   1.4e-18      30     194 ..      90     245 ..      50     246 .. 0.79
   2 !   38.7   0.6   3.9e-14   3.9e-14     147     251 ..     237     333 ..     233     334 .. 0.97

  Alignments for each domain:
  == domain 1  score: 53.2 bits;  conditional E-value: 1.4e-18
      DUF4097  30 akklkkqkveetggtLsitqkekngvstgfik..elssgekskitiylPkktkledlqvkassGdlsvekatklkaetlelksssGdltlsnvsaktl 125
                  + k +     ++  t +i+ ++++  s + ++   ++s     + + +P + k   ++ +++s  +s++    +++++l+++   + ++ls v+ak++
  VIMSS355032  90 DVKEE-----KNKITATINTTRTQNQSELSFFniGIFSDFTPNVSVQIPNNVKKLVIDGSTHS-PVSLN---AFNVDELTTNLPNSYVSLSGVKAKKM 178
                  22222.....333333333333333333322244478888899********955555555566.8**99...9************************* PP

      DUF4097 126 tvksesGdvtiegseakklklqltsGdieleslsletldltsssGdltlsntklegsltitassGdvdl 194
                  t++s++G    ++++ak++ +++t+Gdi l+s+ +++++ t++sGd++++n++  g++++t+++Gd+++
  VIMSS355032 179 TLNSSDGIYLSADTSAKTATVETTDGDITLDSAYFDEIKNTTTSGDIRVQNAR--GNIQATTTDGDISV 245
                  *************************************************9765..66**********85 PP

  == domain 2  score: 38.7 bits;  conditional E-value: 3.9e-14
      DUF4097 147 qltsGdieleslsletldltsssGdltlsntklegsltitassGdvdlslpee.kkaavdassesGdvslpkkreeeekesnsisaseknakkkvsvs 243
                  ++t+Gdi++ ++++e +++ s+ Gd+ l++  + ++lt+    Gd+ ++  e  ++++++ +s+ Gdv+l +        ++++s++++ a+++ ++s
  VIMSS355032 237 TTTDGDISVYDFKGE-ANFSSENGDFSLDMPAVPKKLTVALVHGDIYVNSGEIlRNISIKGESKLGDVQLLN--------KERTSYKNGRADTEFNLS 325
                  68*************.**********************************888*******************........99**************** PP

      DUF4097 244 tssGDitv 251
                  ++ GDitv
  VIMSS355032 326 SEFGDITV 333
                  *******9 PP



Or compare VIMSS355032 to CDD or PaperBLAST