PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS7618196 to PF13349 (DUF4097)

VIMSS7618196 has 496 amino acids

Query:       DUF4097  [M=252]
Accession:   PF13349.6
Description: Putative adhesin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence     Description
    ------- ------ -----    ------- ------ -----   ---- --  --------     -----------
    2.6e-21   62.2   4.0    2.6e-21   62.2   4.0    2.6  2  VIMSS7618196  


Domain annotation for each sequence (and alignments):
>> VIMSS7618196  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -2.7   0.3      0.16      0.16     214     241 ..      43      70 ..      39      76 .. 0.65
   2 !   62.2   4.0   2.6e-21   2.6e-21      63     252 .]     306     492 ..     246     492 .. 0.83

  Alignments for each domain:
  == domain 1  score: -2.7 bits;  conditional E-value: 0.16
       DUF4097 214 slpkkreeeekesnsisaseknakkkvs 241
                   ++p+   e+++++++ ++++++a k+ +
  VIMSS7618196  43 TAPEAHSEQTETDDQSTQEQQEANKDTD 70 
                   6666566777777777777777766655 PP

  == domain 2  score: 62.2 bits;  conditional E-value: 2.6e-21
       DUF4097  63 lssgekskitiylPkktkledlqvkassGdlsvekatklkaetlelksssGdltlsnvsaktltvksesGdvtiegseakklklqltsGdielesls 159
                    ++  +  ++i+lPk t ++ ++v+  +G+ +++    ++ +++ +ks+ G+++ +nv +   +  + +G ++++gs++ +l l++ +Gd++++   
  VIMSS7618196 306 PNKRVQADLVISLPKRT-YDHVSVRLLNGSADLT---GVNGKDFYVKSTNGQMNFTNVDGVMIESEGVNGSIKVQGSHTHDLLLTTVNGDVSVDADP 398
                   567788899********.***********99999...9*******************************************************9999 PP

       DUF4097 160 letldltsssGdltlsntklegsltitassGdvdlslpeekkaavdassesGdvslpk.kreeeekesnsis.aseknakkkvsvstssGDitvk 252
                   ++ + l++  G +++ + ++ ++++ t+  G+v++ +p + +++ +a+++ G++++   +  e  k  ++++    +++  +++++t+sG+i++k
  VIMSS7618196 399 AT-AALKTVNGTVRATYHTDFTKIEGTSMNGNVKVAVPASIALKGEARTHFGSIKSRLsNVAEPAKGLKRFElDRPGTGNSELKLNTTSGNIQLK 492
                   98.*******************************************************96666666666665156689999***********985 PP



Or compare VIMSS7618196 to CDD or PaperBLAST