PaperBLAST – Find papers about a protein or its homologs

 

Align VIMSS915745 to PF13349 (DUF4097)

VIMSS915745 has 278 amino acids

Query:       DUF4097  [M=252]
Accession:   PF13349.6
Description: Putative adhesin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------    -----------
    3.1e-25   75.1  11.6    3.8e-25   74.8  11.6    1.1  1  VIMSS915745  


Domain annotation for each sequence (and alignments):
>> VIMSS915745  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   74.8  11.6   3.8e-25   3.8e-25       1     252 []      44     278 .]      44     278 .] 0.94

  Alignments for each domain:
  == domain 1  score: 74.8 bits;  conditional E-value: 3.8e-25
      DUF4097   1 ikeldissesadvtikesddekitveystakklkkqkveetggtLsitqkekngvstgfikelssgekskitiylPkktkledlqvkassGdlsveka 98 
                  i++l+is+  ++v+i+ ++  k+ v  +++ ++ + + +++++ Lsi++k+  +  +g++++ + ++++k+ti +P+k  l++l++++  G+++++  
  VIMSS915745  44 IEHLSISTVTTNVNIISGK--KLAVYFTGD-NKIN-V-TKNNKRLSIKEKRAVDRGYGLNFNPFHSNNRKLTIVVPEKD-LKSLNIQSLLGEIDLN-- 133
                  689***************9..566544444.4444.3.39********************9******************.****************.. PP

      DUF4097  99 tklkaetlelksssGdltlsnvsaktltvksesGdvtiegseakklklqltsGdieleslsletldltsssGdltlsntklegsltitassGdvdlsl 196
                   +++++ ++l++++  ++l++ +++++++ s+  ++ i++  + + +++l+ G +++++ +l++  + ++ Gd+ +   k ++ ++++++ G+++  +
  VIMSS915745 134 -QVNLKHVSLETDR-IIQLKRSELNQVNIESSKANFYITDCLIREGRMKLDKGITHVKNSTLSDTVFLVNRGDISMTDMKSNNDIKASTQRGNINYHF 229
                  .9*********998.8********************************************************************************** PP

      DUF4097 197 pee.kkaavdassesGdvslpkkreeeekesnsisaseknakkkvsvstssGDitvk 252
                   e+ k++ ++++   G+ ++++        ++  +++ +n+++ +++ t +GDi+++
  VIMSS915745 230 GEKpKNTLLKLHPGHGNKEIKN--------RYFDKGKVGNSDNILEFYTVDGDIKIE 278
                  9999999999999999999999........99999********************95 PP



Or compare VIMSS915745 to CDD or PaperBLAST