PaperBLAST – Find papers about a protein or its homologs

 

Align WP_003564216.1 to PF13349 (DUF4097)

WP_003564216.1 has 493 amino acids

Query:       DUF4097  [M=252]
Accession:   PF13349.6
Description: Putative adhesin
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------       -----------
    4.1e-20   58.3   4.4    3.5e-19   55.2   2.9    2.3  2  WP_003564216.1  


Domain annotation for each sequence (and alignments):
>> WP_003564216.1  
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !    1.8   0.0    0.0072    0.0072     196     217 ..     237     258 ..     213     280 .. 0.72
   2 !   55.2   2.9   3.5e-19   3.5e-19      64     252 .]     304     489 ..     291     489 .. 0.91

  Alignments for each domain:
  == domain 1  score: 1.8 bits;  conditional E-value: 0.0072
         DUF4097 196 lpeekkaavdassesGdvslpk 217
                     +p+++++ +d+++++Gdv+ ++
  WP_003564216.1 237 FPDSQATILDVKVANGDVKFKT 258
                     5555666666666666665544 PP

  == domain 2  score: 55.2 bits;  conditional E-value: 3.5e-19
         DUF4097  64 ssgekskitiylPkktkledlqvkassGdlsvekatklkaetlelksssGdltlsnvsaktltvksesGdvtiegseakklklqltsGdielesl 158
                     ++  +  ++i+lPk + ++ ++v+  +G+ +++    ++ +++ +ks+ G+++ ++v +   +  + +G ++++g ++ +l l++ +Gd++++  
  WP_003564216.1 304 NKRVQADLVISLPKRS-YDHVAVRLLNGSADLT---GITGKDFYVKSTNGQMNFTHVDGVMIESEGVNGSIKVQGGHTHDLLLTTVNGDVSVDAD 394
                     55667789********.***********99999...9*******************************************************999 PP

         DUF4097 159 sletldltsssGdltlsntklegsltitassGdvdlslpeekkaavdassesGdvslpk..kreeeekesnsisaseknakkkvsvstssGDitv 251
                      ++ + l++  G +++ + ++ ++l+ t+  G+v++ +p++ +++ +++++ G++++      e  +  ++      ++++ +++++t+sG+i++
  WP_003564216.1 395 PAT-AALKTVNGTVRATYHTDFTTLEGTSMNGNVKVAVPSSIALNGEVRTHFGSIKSRLseVAEPAKGIKRLELTRPGTGSSEMKLNTTSGNIQL 488
                     998.*******************************************************74444444455555667799**************98 PP

         DUF4097 252 k 252
                     k
  WP_003564216.1 489 K 489
                     5 PP



Or compare WP_003564216.1 to CDD or PaperBLAST